@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : F8VRV3_HUMAN: (2017-06-02 )
WYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_5(2IZV)

[Raw transfer]
43 HHSearch 100.00100% 0 - C- -2C9W - SOCS2_HUMAN -
2 PsiBlast_PDB 100.00100% 0 - C- -4JGH - SOCS2_HUMAN -
1 PsiBlast_PDB 100.00100% 0 - C- -2C9W - SOCS2_HUMAN -
3 PsiBlast_PDB 95.6698% 0 - C- -5BO4 - SOCS2_HUMAN -
49 HHSearch 70.3733%-117 - C4 -2IZV 3.3
22 PsiBlast_CBE 70.0142%-126 - C4 -4GL9 - SOCS3_MOUSE -
5 PsiBlast_PDB 69.2842%-134 - C4 -4GL9 - SOCS3_MOUSE -
23 PsiBlast_CBE 68.7342%-116 - C4 -4GL9 - SOCS3_MOUSE -
21 PsiBlast_CBE 67.6842%-118 - C4 -4GL9 - SOCS3_MOUSE -
63 Fugue 64.9832% 12 - C4 -2IZV - -
46 HHSearch 61.5128%-127 - C4 -2LNW - -
54 HHSearch 61.2028%-132 - C4 -2CRH - -
53 HHSearch 59.2623%-175 * C4 *3US4 - -
16 PsiBlast_PDB 58.8136% -14 - C4 -2IUG - -
18 PsiBlast_PDB 58.3636% -11 - C4 -2IUI - P85A_HUMAN -
17 PsiBlast_PDB 58.1436% -18 - C4 -2IUH - KIT_HUMAN -
62 HHSearch 57.9938% -91 - C4 -2VIF - KIT_HUMAN -
47 HHSearch 57.8236% -26 - C4 -2IUG - -
24 PsiBlast_CBE 57.2936% -12 - C4 -2IUI - -
56 HHSearch 55.8525% -35 - C4 -2OZO - ZAP70_HUMAN -