@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : FGR_HUMAN: (2017-06-02 )
WYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAYSLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQHY

Atome Classification :

(95 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_A_4(1HCS)

[Raw transfer]




ACE_B_3(1CSZ)

[Raw transfer]




787_B_2(1O4R)

[Raw transfer]




256_B_2(1O4Q)

[Raw transfer]




876_A_2(1O4B)

[Raw transfer]




493_B_2(1O49)

[Raw transfer]




UR2_A_2(1SKJ)

[Raw transfer]




791_B_2(1O4P)

[Raw transfer]




852_B_2(1O44)

[Raw transfer]




772_B_2(1O4H)

[Raw transfer]




CIT_B_2(1O4L)

[Raw transfer]




687_B_2(1O45)

[Raw transfer]




CC0_A_2(1IJR)
LCK_HUMAN
[Raw transfer]




262_B_2(1O4D)

[Raw transfer]




299_B_2(1O4E)

[Raw transfer]




OXD_B_2(1O4N)

[Raw transfer]




HPS_C_3(1O4O)

[Raw transfer]




843_B_2(1O42)

[Raw transfer]




MLA_B_2(1O4M)

[Raw transfer]




I59_A_2(1O4G)

[Raw transfer]




1C5_A_2(1BKM)

[Raw transfer]




197_B_2(1O4A)

[Raw transfer]




PTC_C_5(1IS0)
SRC_RSVSA
[Raw transfer]




853_A_2(1O48)

[Raw transfer]




821_B_2(1O43)

[Raw transfer]




PSN_B_2(1O4K)

[Raw transfer]




903_B_2(1O46)

[Raw transfer]




219_B_2(1O4I)

[Raw transfer]




300_B_2(1O41)

[Raw transfer]




PTC_D_6(1IS0)

[Raw transfer]




GOL_A_4(4D8K)

[Raw transfer]




GOL_A_4(4D8K)

[Raw transfer]




IS2_A_2(1O4J)

[Raw transfer]




790_B_2(1O4F)

[Raw transfer]




GOL_A_3(5DC4)

[Raw transfer]




822_B_2(1O47)

[Raw transfer]




CC1_D_4(1FBZ)
?
[Raw transfer]




CC1_C_3(1FBZ)
LCK_HUMAN
[Raw transfer]




CHAIN_I_2(1BHF)

[Raw transfer]

-

CHAIN_C_2(1A09)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A09)

[Raw transfer]

-

CHAIN_K_9(1X27)
?
[Raw transfer]

-

CHAIN_D_4(1A1A)

[Raw transfer]

-

CHAIN_D_4(1A1E)

[Raw transfer]

-

CHAIN_D_4(1A1C)

[Raw transfer]

-

CHAIN_C_2(1A1B)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A1B)

[Raw transfer]

-

CHAIN_C_3(1A1C)
SRC_HUMAN
[Raw transfer]

-

CHAIN_J_8(1X27)
?
[Raw transfer]

-

CHAIN_B_2(1SHA)

[Raw transfer]

-

CHAIN_B_2(1CWE)
?
[Raw transfer]

-

CHAIN_C_3(1A1E)
SRC_HUMAN
[Raw transfer]

-

CHAIN_N_12(1X27)
?
[Raw transfer]

-

CHAIN_C_2(1A08)
SRC_HUMAN
[Raw transfer]

-

CHAIN_P_2(1CWD)
?
[Raw transfer]

-

CHAIN_B_2(1KC2)

[Raw transfer]

-

CHAIN_M_11(1X27)
?
[Raw transfer]

-

CHAIN_D_4(1A08)

[Raw transfer]

-

CHAIN_C_2(1A1A)
SRC_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

EDO_A_6(4U17)
FYN_HUMAN
[Raw transfer]




CHAIN_D_4(1CWE)
?
[Raw transfer]

-

CHAIN_B_2(1SHB)

[Raw transfer]

-

CHAIN_I_7(1X27)

[Raw transfer]

-

ACE_C_5(1A1A)
SRC_HUMAN
[Raw transfer]




CHAIN_B_2(1SHD)

[Raw transfer]

-

CHAIN_D_4(1A07)

[Raw transfer]

-

CHAIN_L_10(1X27)
?
[Raw transfer]

-

CHAIN_A_1(1HCS)

[Raw transfer]

-

CHAIN_A_1(1HCT)

[Raw transfer]

-

CHAIN_B_2(1LCJ)
LCK_HUMAN
[Raw transfer]

-

CHAIN_E_4(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_P_2(1AOT)

[Raw transfer]

-

CHAIN_D_4(1P13)
SRC_CHICK
[Raw transfer]

-

EDO_A_6(4U17)
?
[Raw transfer]




CHAIN_F_6(1SPS)

[Raw transfer]

-

CHAIN_B_2(1F1W)

[Raw transfer]

-

CHAIN_C_2(1A07)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_2(1IS0)
SRC_RSVSA
[Raw transfer]

-

CHAIN_B_2(1LKL)
?
[Raw transfer]

-

CHAIN_C_3(1P13)

[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_C_3(1NZL)

[Raw transfer]

-

CHAIN_C_3(1NZV)

[Raw transfer]

-

CHAIN_B_2(1LCK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_P_2(1AOU)

[Raw transfer]

-

CHAIN_P_2(1AOU)

[Raw transfer]

-

CHAIN_D_4(1IS0)

[Raw transfer]

-

CHAIN_F_6(1SPS)
SRC_RSVSA
[Raw transfer]

-

266 HHSearch 89.8784% -96 - C3 -4U1P Calc... FYN_HUMAN
9 PsiBlast_PDB 89.8784% -96 - C3 -4U1P - FYN_HUMAN -
5 PsiBlast_PDB 89.4284% -96 - C3 -2MRJ Calc... FYN_HUMAN
4 PsiBlast_PDB 88.2584% -93 - C3 -2MQI Calc... FYN_HUMAN
6 PsiBlast_PDB 87.8784% -96 - C3 -3UF4 Calc... FYN_MOUSE
8 PsiBlast_PDB 85.8684% -93 - C3 -2MRK Calc... FYN_HUMAN
3 PsiBlast_PDB 85.8284%-108 - C3 -1G83 Calc... FYN_HUMAN
1 PsiBlast_PDB 84.9784% -80 - C3 -1AOT 2.1
2 PsiBlast_PDB 83.6984% -89 - C3 -1AOU 4.7
67 PsiBlast_CBE 82.2966%-118 - C3 -1A07 3.5
278 HHSearch 82.2566%-129 - C3 -4U5W Calc... HCK_HUMAN
129 PsiBlast_CBE 82.1562%-127 - C3 -1X27 6.0 ?
64 PsiBlast_CBE 81.8466%-130 - C3 -1A09 5.7 SRC_HUMAN
16 PsiBlast_PDB 81.3366%-131 - C3 -1SPR Calc... SRC_RSVSA
14 PsiBlast_PDB 81.3366%-126 - C3 -1SHA 7.2
120 PsiBlast_CBE 81.2062%-125 - C3 -1CWE 5.1 ?
15 PsiBlast_PDB 81.0666%-124 - C3 -1SHB 3.8
27 PsiBlast_CBE 80.9866%-133 - C3 -1NZV 6.0
20 PsiBlast_PDB 80.9866%-141 - C3 -1P13 5.4 SRC_CHICK
58 PsiBlast_CBE 80.8966%-131 - C3 -1A1E 6.3 SRC_HUMAN
131 PsiBlast_CBE 80.7762%-102 - C3 -1X27 5.9 ?
28 PsiBlast_CBE 80.7666%-129 - C3 -1NZL 6.6
68 PsiBlast_CBE 80.7466%-126 - C3 -1A07 3.4 SRC_HUMAN
60 PsiBlast_CBE 80.6566%-118 - C3 -1A1C 6.5 SRC_HUMAN
130 PsiBlast_CBE 80.5962%-116 - C3 -1X27 3.7 ?
133 PsiBlast_CBE 80.4461%-128 - C3 -1IJR 8.2 LCK_HUMAN
61 PsiBlast_CBE 80.3166%-124 - C3 -1A1B 5.9
72 PsiBlast_CBE 80.2765%-127 - C3 -1BKM 6.7
66 PsiBlast_CBE 80.2566%-117 - C3 -1A08 5.7 SRC_HUMAN
56 PsiBlast_CBE 80.1266%-135 - C3 -1HCS 3.9
128 PsiBlast_CBE 80.0662%-106 - C3 -1X27 4.5 ?
24 PsiBlast_CBE 80.0066%-123 - C3 -1IS0 4.1
29 PsiBlast_CBE 79.9966%-134 - C3 -1P13 5.1
54 PsiBlast_CBE 79.9166%-146 - C3 -1SHD 6.4
50 PsiBlast_CBE 79.8466%-118 - C3 -1O44 8.4
12 PsiBlast_PDB 79.7666%-131 - C3 -1IS0 4.7 SRC_RSVSA
17 PsiBlast_PDB 79.6366%-115 - C3 -1SPS 2.4 SRC_RSVSA
63 PsiBlast_CBE 79.4066%-127 - C3 -1A09 5.6
57 PsiBlast_CBE 79.2166%-117 - C3 -1A1E 6.7
40 PsiBlast_CBE 79.1666%-123 - C3 -1O4H 3.7
59 PsiBlast_CBE 79.1266%-120 - C3 -1A1C 7.0
135 PsiBlast_CBE 79.0961%-133 - C3 -1FBZ 6.8 LCK_HUMAN
268 HHSearch 79.0563%-106 - C3 -4D8K 3.2
49 PsiBlast_CBE 79.0266%-124 - C3 -1O45 7.4
10 PsiBlast_PDB 79.0267%-110 - C3 -1A1A 4.5 SRC_HUMAN
42 PsiBlast_CBE 78.9566%-120 - C3 -1O4D 2.4
43 PsiBlast_CBE 78.9166%-112 - C3 -1O4B 5.9
37 PsiBlast_CBE 78.8966%-128 - C3 -1O4K 3.5
110 PsiBlast_CBE 78.8765%-122 - C3 -1F1W 6.1
62 PsiBlast_CBE 78.7766%-119 - C3 -1A1B 5.9 SRC_HUMAN
126 PsiBlast_CBE 78.7662%-106 - C3 -4D8K 3.2
55 PsiBlast_CBE 78.6266%-115 - C3 -1HCT 3.0
46 PsiBlast_CBE 78.5966%-115 - C3 -1O48 8.4
127 PsiBlast_CBE 78.5562%-112 - C3 -1X27 5.4 ?
121 PsiBlast_CBE 78.5562%-119 - C3 -1CWD 4.1 ?
34 PsiBlast_CBE 78.5366%-121 - C3 -1O4N 3.4
132 PsiBlast_CBE 78.5162%-115 - C3 -1X27 4.0
117 PsiBlast_CBE 78.5162%-107 - C3 -1LKL 3.0 ?
51 PsiBlast_CBE 78.4966%-118 - C3 -1O43 6.4
41 PsiBlast_CBE 78.3866%-124 - C3 -1O4E 3.4
39 PsiBlast_CBE 78.2666%-128 - C3 -1O4I 2.4
136 PsiBlast_CBE 78.2462%-139 - C3 -1KC2 6.2
38 PsiBlast_CBE 78.2066%-121 - C3 -1O4J 2.8
23 PsiBlast_CBE 78.0867%-106 - C3 -1A1A 6.3
65 PsiBlast_CBE 78.0266%-121 - C3 -1A08 6.4
122 PsiBlast_CBE 77.9962%-112 - C3 -1LCK 3.1 LCK_HUMAN
48 PsiBlast_CBE 77.9866%-117 - C3 -1O46 7.9
35 PsiBlast_CBE 77.9666%-122 - C3 -1O4M 3.1
32 PsiBlast_CBE 77.8366%-113 - C3 -1O4P 5.2
124 PsiBlast_CBE 77.8266%-125 - C3 -1O4F 2.5
113 PsiBlast_CBE 77.8162%-116 - C3 -1BHF 4.8
26 PsiBlast_CBE 77.8166%-136 - C3 -1SPS 4.5 SRC_RSVSA
134 PsiBlast_CBE 77.6861%-130 - C3 -1FBZ 6.6 ?
25 PsiBlast_CBE 77.6866%-118 - C3 -1SPS 5.2
53 PsiBlast_CBE 77.6566%-125 - C3 -1O41 2.7
119 PsiBlast_CBE 77.6262%-132 - C3 -1CWE 5.2 ?
114 PsiBlast_CBE 77.5662%-122 - C3 -1LCJ 4.5 LCK_HUMAN
265 HHSearch 77.4863%-108 - C3 -1LKK 7.3 LCK_HUMAN
30 PsiBlast_CBE 77.4066%-127 - C3 -1O4R 5.7
52 PsiBlast_CBE 77.3966%-113 - C3 -1O42 7.4
36 PsiBlast_CBE 77.2566%-125 - C3 -1O4L 3.9
118 PsiBlast_CBE 77.1962%-108 - C3 -1LKK 7.3 LCK_HUMAN
31 PsiBlast_CBE 77.1666%-126 - C3 -1O4Q 3.5
11 PsiBlast_PDB 77.1066%-133 - C3 -1SKJ 6.9
123 PsiBlast_CBE 76.9766%-119 - C3 -1O4G 3.8
44 PsiBlast_CBE 76.9066%-114 - C3 -1O4A 7.2
45 PsiBlast_CBE 76.7766%-112 - C3 -1O49 6.6
47 PsiBlast_CBE 76.4866%-110 - C3 -1O47 7.9
33 PsiBlast_CBE 76.4866%-115 - C3 -1O4O 3.0
21 PsiBlast_CBE 73.7584% -43 - C3 -4U17 2.9 ?
7 PsiBlast_PDB 72.7984% -41 - C3 -4U17 3.3 FYN_HUMAN
281 HHSearch 70.6241%-139 - C3 -5DC4 2.8
283 Fugue 69.4084% 120 - C3 -1AOU 4.7
260 PsiBlast_CBE 60.2632%-157 - C3 -1CSZ Error
272 HHSearch 59.0631%-105 - C3 -3PQZ 2.4 GRB7_HUMAN