@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : G5E9R1_HUMAN: (2017-06-02 )
WYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_5(2IZV)

[Raw transfer]
104 HHSearch 98.0255% 0 - C- -2C9W - SOCS2_HUMAN -
3 PsiBlast_PDB 96.9454% 0 - C- -4JGH - SOCS2_HUMAN -
1 PsiBlast_PDB 96.9454% 0 - C- -2C9W - SOCS2_HUMAN -
2 PsiBlast_PDB 93.4754% 0 - C- -5BO4 - SOCS2_HUMAN -
22 PsiBlast_CBE 79.6343%-141 - C4 -4GL9 - SOCS3_MOUSE -
4 PsiBlast_PDB 79.3943%-150 * C4 *4GL9 - SOCS3_MOUSE -
23 PsiBlast_CBE 79.0943%-132 - C4 -4GL9 - SOCS3_MOUSE -
21 PsiBlast_CBE 77.0043%-132 - C4 -4GL9 - SOCS3_MOUSE -
119 HHSearch 74.6635%-139 - C4 -2IZV 3.4
111 HHSearch 73.0832%-191 - C4 -3US4 - -
7 PsiBlast_PDB 72.4635%-125 - C4 -2IZV - -
107 HHSearch 70.7835%-166 - C- -3EAZ - CSK_HUMAN -
126 Fugue 69.2136% -12 - C4 -2IZV - -
123 HHSearch 68.9933% -73 - C4 -4L23 - -
6 PsiBlast_PDB 68.0335%-116 - C4 -2VIF - KIT_HUMAN -
106 HHSearch 67.5933% -46 - C4 -2IUG - -
12 PsiBlast_PDB 66.8835% -18 - C4 -2IUI - P85A_HUMAN -
24 PsiBlast_CBE 65.8235% -19 - C4 -2IUI - -
115 HHSearch 65.1329%-147 - C4 -2CRH - -
20 PsiBlast_PDB 64.2135% -90 - C4 -4WAF - -