@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : H0YBC2_HUMAN: (2017-06-02 )
KSLSTGELEEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHY

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_B_2(2IUH)
KIT_HUMAN
[Raw transfer]

-

CHAIN_C_3(2IUI)
P85A_HUMAN
[Raw transfer]

-

CHAIN_D_4(2IUI)

[Raw transfer]

-

CHAIN_B_2(1FU5)

[Raw transfer]

-

182 HHSearch 90.5291% -86 - C6 -2IUG Calc...
10 PsiBlast_PDB 89.08100%-112 - C6 -2IUH 8.6 KIT_HUMAN
8 PsiBlast_PDB 87.91100%-111 - C6 -4L2Y Calc...
21 PsiBlast_CBE 87.57100%-110 - C6 -2IUI 5.9
6 PsiBlast_PDB 87.51100%-107 - C6 -4L1B Calc...
9 PsiBlast_PDB 87.49100%-102 - C6 -2IUG - -
11 PsiBlast_PDB 87.34100%-117 - C6 -2IUI 5.8 P85A_HUMAN
7 PsiBlast_PDB 86.96100%-107 - C6 -4L23 Calc...
4 PsiBlast_PDB 86.91100%-120 - C6 -3HHM Calc...
199 HHSearch 86.5191% -98 - C6 -3HHM - -
17 PsiBlast_PDB 86.19100%-127 - C6 -5FI4 Calc...
5 PsiBlast_PDB 84.74100%-126 - C6 -3HIZ Calc... P85A_HUMAN
2 PsiBlast_PDB 82.15100% - - C6 -4OVU Calc... P85A_HUMAN
16 PsiBlast_PDB 82.04100%-172 - C6 -4WAF Calc...
19 PsiBlast_PDB 76.33100% 0 - C- -4ZOP - -
12 PsiBlast_PDB 75.9598% -71 - C6 -2PNA Calc...
13 PsiBlast_PDB 75.8098% -54 - C6 -2PNB Calc...
18 PsiBlast_PDB 74.74100%-136 - C6 -5ITD Calc...
3 PsiBlast_PDB 72.29100% 0 - C- -4OVV - -
15 PsiBlast_PDB 71.8097% -89 - C6 -1FU6 Calc...
14 PsiBlast_PDB 59.7397% -34 - C6 -1FU5 0.4