@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : P85A_HUMAN: (2017-06-02 )
WYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHY

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_B_2(2IUH)
KIT_HUMAN
[Raw transfer]

-

CHAIN_C_3(2IUI)
P85A_HUMAN
[Raw transfer]

-

CHAIN_D_4(2IUI)

[Raw transfer]

-

CHAIN_B_2(1FU5)

[Raw transfer]

-

11 PsiBlast_PDB 92.96100%-115 - C4 -2IUH 9.3 KIT_HUMAN
7 PsiBlast_PDB 92.51100%-111 - C4 -4L2Y Calc...
5 PsiBlast_PDB 92.29100%-112 - C4 -4L1B Calc...
12 PsiBlast_PDB 92.20100%-119 - C4 -2IUI 6.9 P85A_HUMAN
21 PsiBlast_CBE 91.79100%-114 - C4 -2IUI 6.9
182 HHSearch 91.64100%-114 - C4 -4L23 Calc...
6 PsiBlast_PDB 91.64100%-114 - C4 -4L23 - -
9 PsiBlast_PDB 91.41100%-129 - C4 -3HIZ Calc... P85A_HUMAN
167 HHSearch 91.26100%-108 - C4 -2IUG Calc...
10 PsiBlast_PDB 91.26100%-108 - C4 -2IUG - -
175 HHSearch 89.65100%-116 - C4 -3HHM Calc...
8 PsiBlast_PDB 89.65100%-116 - C4 -3HHM - -
14 PsiBlast_PDB 85.33100%-125 - C4 -5FI4 Calc...
13 PsiBlast_PDB 82.85100%-161 - C4 -4WAF Calc...
3 PsiBlast_PDB 82.73100% - - C4 -4OVU Calc... P85A_HUMAN
16 PsiBlast_PDB 82.2098% -80 - C4 -2PNA Calc...
17 PsiBlast_PDB 81.6398% -67 - C4 -2PNB Calc...
2 PsiBlast_PDB 80.06100% 0 - C- -4ZOP - -
19 PsiBlast_PDB 78.9597% -94 - C4 -1FU6 Calc...
1 PsiBlast_PDB 75.49100%-157 - C4 -4YKN Calc... PK3CA_HUMAN
18 PsiBlast_PDB 68.7997% -72 - C4 -1FU5 0.5