@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : P85B_HUMAN: (2017-06-02 )
WYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHY

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_B_2(2IUH)
KIT_HUMAN
[Raw transfer]

-

CHAIN_D_4(2IUI)

[Raw transfer]

-

CHAIN_C_3(2IUI)
P85A_HUMAN
[Raw transfer]

-

CHAIN_B_2(1FU5)

[Raw transfer]

-

10 PsiBlast_PDB 92.2386%-125 - C4 -2IUH 9.0 KIT_HUMAN
4 PsiBlast_PDB 91.9186%-117 - C4 -4L2Y Calc...
139 HHSearch 91.6187%-121 - C4 -4L23 Calc...
8 PsiBlast_PDB 91.3386%-145 - C4 -3HIZ Calc... P85A_HUMAN
3 PsiBlast_PDB 91.3386%-121 - C4 -4L23 - -
2 PsiBlast_PDB 91.1086%-117 - C4 -4L1B Calc...
11 PsiBlast_PDB 90.2486%-122 - C4 -2IUI 7.2 P85A_HUMAN
131 HHSearch 89.4787%-122 - C4 -3HHM Calc...
7 PsiBlast_PDB 89.2086%-122 - C4 -3HHM - -
21 PsiBlast_CBE 88.6786%-117 - C4 -2IUI 7.1
124 HHSearch 88.4187%-116 - C4 -2IUG Calc...
9 PsiBlast_PDB 88.1386%-116 - C4 -2IUG - -
16 PsiBlast_PDB 85.5786%-132 - C4 -5FI4 Calc...
15 PsiBlast_PDB 81.5386%-155 - C4 -4WAF Calc...
5 PsiBlast_PDB 81.0586% - - C4 -4OVU Calc... P85A_HUMAN
12 PsiBlast_PDB 79.4586% 0 - C- -4ZOP - -
13 PsiBlast_PDB 78.9586% -85 - C4 -2PNA Calc...
14 PsiBlast_PDB 78.4686% -75 - C4 -2PNB Calc...
17 PsiBlast_PDB 74.3486%-131 - C4 -5ITD Calc...
19 PsiBlast_PDB 73.6985% -97 - C4 -1FU6 Calc...
18 PsiBlast_PDB 63.4985% -75 - C4 -1FU5 0.1