@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q5TEW3_HUMAN: (2017-06-03 )
WYHGRIPRQVSENLVQRDGDFLVRDSLSSPGNFVLTCQWKNLAQHFKINRTVLRLSEAYSRVQYQFEMESFDSIPGLVRCY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_B_2(3OV1)
GRB2_HUMAN
[Raw transfer]

-

231 HHSearch 83.1640%-148 - C5 -2KK6 Calc...
238 HHSearch 78.0738% -10 - C5 -3OV1 6.8 GRB2_HUMAN
229 HHSearch 77.1438% -0 - C5 -3WA4 Calc... GRB2_HUMAN
1 PsiBlast_PDB 76.6838%-149 - C5 -2KK6 - -
76 PsiBlast_CBE 74.6539%-150 - C5 -3BKB - -
227 HHSearch 71.0940% 4 - C5 -2DVJ Calc... CRK_HUMAN
228 HHSearch 70.6840% 4 - C5 -2EYZ Calc... CRK_HUMAN
95 PsiBlast_CBE 70.1233% 1 - C5 -1R1S - GRAP2_MOUSE -
96 PsiBlast_CBE 69.6833% 1 - C5 -1R1S - GRAP2_MOUSE -
101 PsiBlast_CBE 69.5433% 12 - C5 -1R1P - GRAP2_MOUSE -
224 HHSearch 69.3940% -4 - C5 -1JU5 Calc... CRK_HUMAN
233 HHSearch 69.1136% -6 - C5 -1I3Z Calc... SH21B_MOUSE
232 HHSearch 68.4237% 12 - C5 -1R1P Calc... GRAP2_MOUSE
98 PsiBlast_CBE 68.0433% 6 - C5 -1R1Q - GRAP2_MOUSE -
99 PsiBlast_CBE 67.7233% 13 - C5 -1R1P - GRAP2_MOUSE -
100 PsiBlast_CBE 67.6833% 5 - C5 -1R1P - GRAP2_MOUSE -
94 PsiBlast_CBE 67.6133% 15 - C5 -1R1S - GRAP2_MOUSE -
97 PsiBlast_CBE 67.5133% 2 - C5 -1R1Q - GRAP2_MOUSE -
235 HHSearch 67.1036% -4 - C5 -2EO3 Calc... CRKL_HUMAN
234 HHSearch 66.9733% 20 - C5 -2CIA Calc...