@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q5TZW1_HUMAN: (2017-06-03 )
WLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLMNHY

Atome Classification :

(40 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_I_3(1BHF)

[Raw transfer]




CC0_A_2(1IJR)
LCK_HUMAN
[Raw transfer]




PHS_B_3(1LCJ)
LCK_HUMAN
[Raw transfer]




PHS_B_4(1LKL)
?
[Raw transfer]




CC1_C_3(1FBZ)
LCK_HUMAN
[Raw transfer]




CHAIN_B_2(1CWE)
?
[Raw transfer]

-

CC1_D_4(1FBZ)
?
[Raw transfer]




CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_D_4(1CWE)
?
[Raw transfer]

-

CHAIN_P_2(1CWD)
?
[Raw transfer]

-

CHAIN_I_7(1X27)

[Raw transfer]

-

CHAIN_B_2(1LCJ)
LCK_HUMAN
[Raw transfer]

-

CHAIN_J_8(1X27)
?
[Raw transfer]

-

CHAIN_I_2(1BHF)

[Raw transfer]

-

CHAIN_N_12(1X27)
?
[Raw transfer]

-

CHAIN_L_10(1X27)
?
[Raw transfer]

-

CHAIN_K_9(1X27)
?
[Raw transfer]

-

ACE_B_3(1LKL)
?
[Raw transfer]




CHAIN_B_2(1JU5)
CRK_HUMAN
[Raw transfer]

-

CHAIN_P_2(1AOT)

[Raw transfer]

-

CHAIN_M_11(1X27)
?
[Raw transfer]

-

EDO_A_6(4U17)
?
[Raw transfer]




CHAIN_B_2(1LKL)
?
[Raw transfer]

-

EDO_A_6(4U17)
FYN_HUMAN
[Raw transfer]




CHAIN_B_2(1LCK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_P_2(1AOU)

[Raw transfer]

-

18 PsiBlast_PDB 82.2154% -60 - C2 -4LUD Calc... HCK_HUMAN
3 PsiBlast_PDB 81.5154% -37 - C2 -4U5W Calc... HCK_HUMAN
122 PsiBlast_CBE 80.6838% -38 - C2 -1A07 - SRC_HUMAN -
264 HHSearch 80.6252% -38 - C2 -4D8K Calc...
15 PsiBlast_PDB 80.6154% -55 - C2 -3VS5 Calc... HCK_HUMAN
9 PsiBlast_PDB 80.5554% -54 - C2 -3VRZ Calc... HCK_HUMAN
22 PsiBlast_CBE 80.0854% -47 - C2 -4LUE Calc... HCK_HUMAN
104 PsiBlast_CBE 79.9238% -39 - C2 -1O44 - -
4 PsiBlast_PDB 79.8854% -35 - C2 -1QCF Calc... HCK_HUMAN
17 PsiBlast_PDB 79.7054% -22 - C2 -3VS7 Calc... HCK_HUMAN
12 PsiBlast_PDB 79.6154% -66 - C2 -3VS2 Calc... HCK_HUMAN
6 PsiBlast_PDB 79.5654% -23 - C2 -2C0O Calc... HCK_HUMAN
43 PsiBlast_CBE 79.1348% -37 - C2 -1LCJ 4.9 LCK_HUMAN
54 PsiBlast_CBE 78.9546% -53 - C2 -1IJR 8.1 LCK_HUMAN
2 PsiBlast_PDB 78.8954% -20 - C2 -3HCK Calc...
45 PsiBlast_CBE 78.8448% -38 - C2 -4D8K - -
13 PsiBlast_PDB 78.6754% -25 - C2 -3VS3 Calc... HCK_HUMAN
100 PsiBlast_CBE 78.6338% -40 - C2 -1O48 - -
19 PsiBlast_PDB 78.5954% -45 - C2 -4LUE Calc... HCK_HUMAN
93 PsiBlast_CBE 78.5038% -45 - C2 -1O4I - -
46 PsiBlast_CBE 77.3048% -27 - C2 -1LKL 3.9 ?
47 PsiBlast_CBE 76.9248% -41 - C2 -1X27 5.4 ?
56 PsiBlast_CBE 76.7946% -51 - C2 -1FBZ 7.3 LCK_HUMAN
52 PsiBlast_CBE 76.4448% -34 - C2 -1X27 4.2
40 PsiBlast_CBE 76.3748% -42 - C2 -1CWE 6.1 ?
55 PsiBlast_CBE 75.6646% -60 - C2 -1FBZ 7.3 ?
42 PsiBlast_CBE 75.3948% -43 - C2 -1BHF 5.3
53 PsiBlast_CBE 75.0848% -36 - C2 -1LKK 7.7 LCK_HUMAN
51 PsiBlast_CBE 74.8548% -41 - C2 -1X27 6.2 ?
39 PsiBlast_CBE 73.2148% -52 - C2 -1CWE 5.5 ?
41 PsiBlast_CBE 73.1748% -40 - C2 -1CWD 4.5 ?
49 PsiBlast_CBE 72.7448% -40 - C2 -1X27 5.7 ?
48 PsiBlast_CBE 71.6548% -31 - C2 -1X27 5.5 ?
44 PsiBlast_CBE 71.4548% -32 - C2 -1LCK 4.4 LCK_HUMAN
50 PsiBlast_CBE 70.9948% -24 - C2 -1X27 4.5 ?
250 HHSearch 68.3335% -59 - C2 -1JU5 3.7 CRK_HUMAN
57 PsiBlast_CBE 68.2646% -20 - C2 -1AOU 4.9
58 PsiBlast_CBE 64.7846% -14 - C2 -1AOT 1.7
61 PsiBlast_CBE 55.8946% -17 - C2 -4U17 3.0 FYN_HUMAN
59 PsiBlast_CBE 52.0346% -7 - C2 -4U17 2.1 ?