@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q6FHA6_HUMAN: (2017-06-03 )
WFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYY

Atome Classification :

(77 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_H_22(1R1P)
GRAP2_MOUSE
[Raw transfer]




ACE_F_20(1R1P)
GRAP2_MOUSE
[Raw transfer]




YVN_D_4(2HUW)
GRB2_HUMAN
[Raw transfer]




YVN_E_5(2HUW)
GRB2_HUMAN
[Raw transfer]




AYI_A_3(3IMJ)
GRB2_HUMAN
[Raw transfer]




C78_R_18(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_N_14(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_V_22(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_T_20(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_Q_17(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_O_15(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_P_16(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_W_23(1CJ1)
GRB2_HUMAN
[Raw transfer]




TVN_A_2(3C7I)
GRB2_HUMAN
[Raw transfer]




C78_U_21(1CJ1)
GRB2_HUMAN
[Raw transfer]




C78_S_19(1CJ1)
GRB2_HUMAN
[Raw transfer]




FYQ_A_3(3IMD)
GRB2_HUMAN
[Raw transfer]




C78_M_13(1CJ1)
GRB2_HUMAN
[Raw transfer]




AYI_B_4(3IMJ)
GRB2_HUMAN
[Raw transfer]




FYQ_B_8(3IMD)
GRB2_HUMAN
[Raw transfer]




FYI_A_2(3IN8)
GRB2_HUMAN
[Raw transfer]




S1S_E_5(2AOB)
GRB2_HUMAN
[Raw transfer]




S1S_C_3(2AOA)
GRB2_HUMAN
[Raw transfer]




AYQ_A_3(3IN7)
GRB2_HUMAN
[Raw transfer]




AYQ_C_4(3IN7)
GRB2_HUMAN
[Raw transfer]




YEN_A_2(3KFJ)
GRB2_HUMAN
[Raw transfer]




S1S_K_11(2AOB)
GRB2_HUMAN
[Raw transfer]




GOL_C_3(2H46)
GRB2_HUMAN
[Raw transfer]




CHAIN_H_8(1R1P)
GRAP2_MOUSE
[Raw transfer]

-

CHAIN_H_8(3N84)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_H_4(1JYQ)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_H_8(1R1S)
GRAP2_MOUSE
[Raw transfer]

-

GOL_F_21(3N84)
GRB2_HUMAN
[Raw transfer]




GOL_B_3(3N8M)
GRB2_HUMAN
[Raw transfer]




DTF_A_2(1X0N)
GRB2_HUMAN
[Raw transfer]




CHAIN_H_8(3N84)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_L_3(1JYQ)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_I_2(1ZFP)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_D_4(1R1S)
GRAP2_MOUSE
[Raw transfer]

-

CHAIN_I_2(1ZFP)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(1R1S)
GRAP2_MOUSE
[Raw transfer]

-

CHAIN_B_2(3WA4)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_J_10(3N84)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(3WA4)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_F_6(1R1S)
GRAP2_MOUSE
[Raw transfer]

-

CHAIN_L_12(3N84)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_K_11(3N84)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_D_4(3N7Y)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_I_2(1BMB)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_E_5(3N7Y)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(4JMH)
?
[Raw transfer]

-

CHAIN_L_8(1FYR)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(4P9V)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_J_6(1FYR)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_K_7(1FYR)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_F_6(1R1P)
GRAP2_MOUSE
[Raw transfer]

-

CHAIN_I_5(1FYR)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(3S8N)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(3S8O)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_E_5(1R1P)
GRAP2_MOUSE
[Raw transfer]

-

CHAIN_B_2(3OVE)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_E_5(1R1P)
GRAP2_MOUSE
[Raw transfer]

-

CHAIN_G_7(1R1P)
GRAP2_MOUSE
[Raw transfer]

-

CHAIN_F_6(3N7Y)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(3OV1)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(3OV1)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(3S8L)
GRB2_HUMAN
[Raw transfer]

-

S1S_E_5(2AOA)
GRB2_HUMAN
[Raw transfer]




CHAIN_B_2(4P9Z)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_B_2(3N8M)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_C_3(2H5K)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_L_2(3MXY)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_L_2(3MXC)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_C_3(1R1Q)
GRAP2_MOUSE
[Raw transfer]

-

CHAIN_I_2(1QG1)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_D_4(1R1Q)
GRAP2_MOUSE
[Raw transfer]

-

CHAIN_J_10(3N84)
GRB2_HUMAN
[Raw transfer]

-

S1S_P_16(2AOB)
GRB2_HUMAN
[Raw transfer]




S1S_J_10(2AOB)
GRB2_HUMAN
[Raw transfer]




CHAIN_L_2(1JYR)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_I_2(1TZE)
GRB2_HUMAN
[Raw transfer]

-

223 HHSearch 92.8296%-150 - C1 -1R1P 7.8 GRAP2_MOUSE
1 PsiBlast_PDB 92.8296%-150 - C1 -1R1P 7.8 GRAP2_MOUSE
23 PsiBlast_CBE 92.7196%-144 - C1 -1R1S 7.5 GRAP2_MOUSE
2 PsiBlast_PDB 92.6196%-157 - C1 -1R1Q 8.8 GRAP2_MOUSE
25 PsiBlast_CBE 92.5796%-159 - C1 -1R1P 7.6 GRAP2_MOUSE
26 PsiBlast_CBE 92.1496%-139 - C1 -1R1P 8.3 GRAP2_MOUSE
24 PsiBlast_CBE 92.1096%-148 - C1 -1R1Q 7.7 GRAP2_MOUSE
27 PsiBlast_CBE 91.7096%-146 - C1 -1R1P 8.2 GRAP2_MOUSE
3 PsiBlast_PDB 91.2496%-145 - C1 -1R1S 7.9 GRAP2_MOUSE
21 PsiBlast_CBE 91.1996%-150 - C1 -1R1S 7.4 GRAP2_MOUSE
22 PsiBlast_CBE 90.9196%-148 - C1 -1R1S 7.4 GRAP2_MOUSE
77 PsiBlast_CBE 75.1855% -57 - C1 -3MXC 7.2 GRB2_HUMAN
10 PsiBlast_PDB 74.1055% -56 - C1 -3IN7 7.5 GRB2_HUMAN
76 PsiBlast_CBE 73.9655% -60 - C1 -3MXY 6.9 GRB2_HUMAN
237 HHSearch 72.9556% -58 - C1 -3OV1 7.6 GRB2_HUMAN
41 PsiBlast_CBE 72.9255% -56 - C1 -2HUW 7.6 GRB2_HUMAN
29 PsiBlast_CBE 72.9255% -44 - C1 -3OVE 8.2 GRB2_HUMAN
54 PsiBlast_CBE 72.8455% -60 - C1 -1BMB 7.8 GRB2_HUMAN
226 HHSearch 72.7656% -58 - C1 -3WA4 8.3 GRB2_HUMAN
14 PsiBlast_PDB 72.7055% -58 - C1 -3OV1 7.6 GRB2_HUMAN
15 PsiBlast_PDB 72.5555% -50 - C1 -3S8L 7.8 GRB2_HUMAN
45 PsiBlast_CBE 72.5155% -58 - C1 -3WA4 8.3 GRB2_HUMAN
9 PsiBlast_PDB 72.2155% -57 - C1 -3IMJ 7.7 GRB2_HUMAN
13 PsiBlast_PDB 72.1855% -59 - C1 -3N8M 7.5 GRB2_HUMAN
11 PsiBlast_PDB 72.1655% -54 - C1 -3IN8 8.0 GRB2_HUMAN
16 PsiBlast_PDB 71.5055% -55 - C1 -3S8N 8.2 GRB2_HUMAN
37 PsiBlast_CBE 71.3355% -47 - C1 -3IMD 6.8 GRB2_HUMAN
18 PsiBlast_PDB 71.2855% -55 - C1 -4P9V 8.0 GRB2_HUMAN
63 PsiBlast_CBE 71.2555% -59 - C1 -1ZFP 7.9 GRB2_HUMAN
35 PsiBlast_CBE 70.9355% -52 - C1 -3IN7 7.5 GRB2_HUMAN
74 PsiBlast_CBE 70.8955% -63 - C1 -1CJ1 7.9 GRB2_HUMAN
70 PsiBlast_CBE 70.6955% -63 - C1 -1CJ1 7.8 GRB2_HUMAN
36 PsiBlast_CBE 70.6755% -50 - C1 -3IMJ 8.3 GRB2_HUMAN
32 PsiBlast_CBE 70.6755% -56 - C1 -3N84 8.0 GRB2_HUMAN
39 PsiBlast_CBE 70.6455% -51 - C1 -3C7I 7.8 GRB2_HUMAN
4 PsiBlast_PDB 70.6055% -52 - C1 -1JYQ 8.0 GRB2_HUMAN
65 PsiBlast_CBE 70.5155% -61 - C1 -1CJ1 7.8 GRB2_HUMAN
19 PsiBlast_PDB 70.4455% -60 - C1 -4P9Z 8.8 GRB2_HUMAN
51 PsiBlast_CBE 70.3255% -58 - C1 -3N7Y 7.0 GRB2_HUMAN
17 PsiBlast_PDB 70.2655% -53 - C1 -3S8O 8.3 GRB2_HUMAN
66 PsiBlast_CBE 70.2455% -61 - C1 -1CJ1 7.8 GRB2_HUMAN
34 PsiBlast_CBE 69.9055% -58 - C1 -3N84 8.6 GRB2_HUMAN
12 PsiBlast_PDB 69.7855% -51 - C1 -3KFJ 7.0 GRB2_HUMAN
5 PsiBlast_PDB 69.7555% -52 - C1 -1JYR 7.3 GRB2_HUMAN
30 PsiBlast_CBE 69.6655% -53 - C1 -3N84 8.3 GRB2_HUMAN
71 PsiBlast_CBE 69.6055% -61 - C1 -1CJ1 7.7 GRB2_HUMAN
53 PsiBlast_CBE 69.4655% -58 - C1 -1TZE 7.7 GRB2_HUMAN
72 PsiBlast_CBE 69.3555% -63 - C1 -1CJ1 7.8 GRB2_HUMAN
73 PsiBlast_CBE 69.3055% -61 - C1 -1CJ1 7.8 GRB2_HUMAN
28 PsiBlast_CBE 69.2955% -48 - C1 -1JYQ 8.7 GRB2_HUMAN
68 PsiBlast_CBE 69.2455% -63 - C1 -1CJ1 7.8 GRB2_HUMAN
40 PsiBlast_CBE 69.2455% -52 - C1 -2HUW 8.3 GRB2_HUMAN
50 PsiBlast_CBE 69.2255% -66 - C1 -3N7Y 7.6 GRB2_HUMAN
20 PsiBlast_PDB 69.1855% -56 - C1 -3N84 2.7 GRB2_HUMAN
31 PsiBlast_CBE 69.1355% -53 - C1 -3N84 8.4 GRB2_HUMAN
75 PsiBlast_CBE 68.9855% -63 - C1 -1CJ1 7.8 GRB2_HUMAN
8 PsiBlast_PDB 68.9155% -51 - C1 -3IMD 7.0 GRB2_HUMAN
69 PsiBlast_CBE 68.6655% -61 - C1 -1CJ1 7.6 GRB2_HUMAN
67 PsiBlast_CBE 68.6655% -61 - C1 -1CJ1 7.7 GRB2_HUMAN
52 PsiBlast_CBE 68.5155% -56 - C1 -3N7Y 6.5 GRB2_HUMAN
33 PsiBlast_CBE 67.7855% -51 - C1 -3N84 2.7 GRB2_HUMAN
56 PsiBlast_CBE 66.7955% -61 - C1 -1QG1 5.5 GRB2_HUMAN
62 PsiBlast_CBE 62.1355% -78 - C1 -2AOA 9.6 GRB2_HUMAN
55 PsiBlast_CBE 59.8055% -61 - C1 -1X0N 8.0 GRB2_HUMAN
46 PsiBlast_CBE 58.4155% -83 - C1 -1FYR 7.3 GRB2_HUMAN
244 Fugue 58.2356% 94 * C1 *1ZFP 7.9 GRB2_HUMAN
60 PsiBlast_CBE 57.8355% -66 - C1 -2AOB 10.2 GRB2_HUMAN
59 PsiBlast_CBE 57.3755% -72 - C1 -2AOB 3.0 GRB2_HUMAN
58 PsiBlast_CBE 56.9555% -78 - C1 -2AOB 10.2 GRB2_HUMAN
44 PsiBlast_CBE 56.4055% -69 - C1 -2H46 2.2 GRB2_HUMAN
48 PsiBlast_CBE 56.1955% -71 - C1 -1FYR 7.0 GRB2_HUMAN
49 PsiBlast_CBE 56.0555% -73 - C1 -1FYR 8.4 GRB2_HUMAN
43 PsiBlast_CBE 55.8255% -59 - C1 -2H5K 7.1 GRB2_HUMAN
47 PsiBlast_CBE 54.4855% -69 - C1 -1FYR 7.1 GRB2_HUMAN
57 PsiBlast_CBE 53.8455% -73 - C1 -2AOB 3.0 GRB2_HUMAN
78 PsiBlast_CBE 49.8451% -42 - C1 -4JMH 8.1 ?
61 PsiBlast_CBE 37.7055% -79 - C1 -2AOA 4.7 GRB2_HUMAN