@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q6NUK7_HUMAN: (2017-06-03 )
WFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHY

Atome Classification :

(85 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_B_3(1LKK)
LCK_HUMAN
[Raw transfer]




ACE_I_3(1BHF)

[Raw transfer]




CC0_A_2(1IJR)
LCK_HUMAN
[Raw transfer]




787_B_2(1O4R)

[Raw transfer]




256_B_2(1O4Q)

[Raw transfer]




UR2_A_2(1SKJ)

[Raw transfer]




CIT_B_2(1O4L)

[Raw transfer]




876_A_2(1O4B)

[Raw transfer]




493_B_2(1O49)

[Raw transfer]




772_B_2(1O4H)

[Raw transfer]




852_B_2(1O44)

[Raw transfer]




OXD_B_2(1O4N)

[Raw transfer]




791_B_2(1O4P)

[Raw transfer]




687_B_2(1O45)

[Raw transfer]




HPS_C_3(1O4O)

[Raw transfer]




262_B_2(1O4D)

[Raw transfer]




299_B_2(1O4E)

[Raw transfer]




MLA_B_2(1O4M)

[Raw transfer]




843_B_2(1O42)

[Raw transfer]




PHS_B_4(1LKL)
?
[Raw transfer]




I59_A_2(1O4G)

[Raw transfer]




1C5_A_2(1BKM)

[Raw transfer]




197_B_2(1O4A)

[Raw transfer]




853_A_2(1O48)

[Raw transfer]




PHS_B_3(1LCJ)
LCK_HUMAN
[Raw transfer]




PSN_B_2(1O4K)

[Raw transfer]




903_B_2(1O46)

[Raw transfer]




219_B_2(1O4I)

[Raw transfer]




821_B_2(1O43)

[Raw transfer]




PHS_B_3(1LCK)
LCK_HUMAN
[Raw transfer]




300_B_2(1O41)

[Raw transfer]




GOL_A_4(4D8K)

[Raw transfer]




CC1_D_4(1FBZ)
?
[Raw transfer]




IS2_A_2(1O4J)

[Raw transfer]




822_B_2(1O47)

[Raw transfer]




790_B_2(1O4F)

[Raw transfer]




CC1_C_3(1FBZ)
LCK_HUMAN
[Raw transfer]




CHAIN_I_2(1BHF)

[Raw transfer]

-

CHAIN_C_2(1A09)
SRC_HUMAN
[Raw transfer]

-

CHAIN_K_9(1X27)
?
[Raw transfer]

-

CHAIN_D_4(1A1A)

[Raw transfer]

-

CHAIN_B_2(1CWE)
?
[Raw transfer]

-

CHAIN_C_3(1A1C)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A09)

[Raw transfer]

-

CHAIN_D_4(1A1C)

[Raw transfer]

-

CHAIN_C_2(1A1B)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A1B)

[Raw transfer]

-

CHAIN_N_12(1X27)
?
[Raw transfer]

-

CHAIN_J_8(1X27)
?
[Raw transfer]

-

CHAIN_D_4(1A1E)

[Raw transfer]

-

CHAIN_C_3(1A1E)
SRC_HUMAN
[Raw transfer]

-

CHAIN_B_2(1SHA)

[Raw transfer]

-

CHAIN_P_2(1CWD)
?
[Raw transfer]

-

CHAIN_M_11(1X27)
?
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A08)

[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_C_2(1A1A)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_2(1A08)
SRC_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

ACE_B_3(1LKL)
?
[Raw transfer]




CHAIN_L_10(1X27)
?
[Raw transfer]

-

CHAIN_I_7(1X27)

[Raw transfer]

-

CHAIN_D_4(1CWE)
?
[Raw transfer]

-

CHAIN_B_2(1KC2)

[Raw transfer]

-

CHAIN_B_2(1LKL)
?
[Raw transfer]

-

CHAIN_B_2(1LCJ)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1SHD)

[Raw transfer]

-

CHAIN_D_2(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_B_2(1SHB)

[Raw transfer]

-

CHAIN_D_4(1A07)

[Raw transfer]

-

CHAIN_D_4(1P13)
SRC_CHICK
[Raw transfer]

-

CHAIN_B_2(1F1W)

[Raw transfer]

-

EDO_A_6(4U17)
FYN_HUMAN
[Raw transfer]




CHAIN_A_1(1HCT)

[Raw transfer]

-

CHAIN_A_1(1HCS)

[Raw transfer]

-

CHAIN_C_2(1A07)
SRC_HUMAN
[Raw transfer]

-

CHAIN_P_2(1AOT)

[Raw transfer]

-

CHAIN_C_2(1IS0)
SRC_RSVSA
[Raw transfer]

-

CHAIN_E_4(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_C_3(1P13)

[Raw transfer]

-

CHAIN_B_2(1LCK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_F_6(1SPS)

[Raw transfer]

-

CHAIN_C_3(1NZV)

[Raw transfer]

-

CHAIN_C_3(1NZL)

[Raw transfer]

-

EDO_A_6(4U17)
?
[Raw transfer]




CHAIN_D_4(1IS0)

[Raw transfer]

-

CHAIN_P_2(1AOU)

[Raw transfer]

-

12 PsiBlast_PDB 85.7671%-148 - C2 -1IJR 8.2 LCK_HUMAN
24 PsiBlast_CBE 84.8772%-142 - C2 -1X27 5.9 ?
10 PsiBlast_PDB 84.6672%-123 - C2 -1LKL 3.9 ?
3 PsiBlast_PDB 84.5572%-143 - C2 -1CWE 6.3 ?
25 PsiBlast_CBE 84.3172%-134 - C2 -1X27 3.9 ?
23 PsiBlast_CBE 83.7872%-123 - C2 -1X27 5.6 ?
4 PsiBlast_PDB 83.4372%-133 - C2 -1X27 4.9
8 PsiBlast_PDB 83.4272%-133 - C2 -1BHF 4.9
2 PsiBlast_PDB 83.3272%-140 - C2 -1CWD 4.2 ?
13 PsiBlast_PDB 83.2671%-149 - C2 -1FBZ 7.6 LCK_HUMAN
267 HHSearch 82.6772%-126 - C2 -1LKK 7.2 LCK_HUMAN
11 PsiBlast_PDB 82.6772%-126 - C2 -1LKK 7.2 LCK_HUMAN
28 PsiBlast_CBE 82.6569%-153 - C2 -4U5W Calc... HCK_HUMAN
258 HHSearch 82.6498% - - C2 -4TZI Calc... LYN_MOUSE
22 PsiBlast_CBE 82.2772%-128 - C2 -1X27 6.1 ?
1 PsiBlast_PDB 82.2397% - - C2 -4TZI - LYN_MOUSE -
6 PsiBlast_PDB 81.9772%-138 - C2 -1LCJ 4.8 LCK_HUMAN
26 PsiBlast_CBE 81.8372%-119 - C2 -1X27 6.0 ?
27 PsiBlast_CBE 81.6371%-150 - C2 -1FBZ 7.7 ?
266 HHSearch 80.8272%-130 - C2 -4D8K 1.9
5 PsiBlast_PDB 80.3272%-128 - C2 -1LCK 3.8 LCK_HUMAN
21 PsiBlast_CBE 80.1672%-153 - C2 -1CWE 5.4 ?
73 PsiBlast_CBE 77.9151%-144 - C2 -1NZL 6.5
71 PsiBlast_CBE 77.9151%-145 - C2 -1NZV 6.0
87 PsiBlast_CBE 76.2850%-145 - C2 -1BKM 6.7
98 PsiBlast_CBE 75.7150%-138 - C2 -1O4H 3.7
67 PsiBlast_CBE 75.3451%-132 - C2 -1SPS 4.8 SRC_RSVSA
126 PsiBlast_CBE 74.8750%-142 - C2 -1A07 3.5 SRC_HUMAN
108 PsiBlast_CBE 74.8750%-135 - C2 -1O44 8.3
92 PsiBlast_CBE 74.8750%-138 - C2 -1O4N 3.4
69 PsiBlast_CBE 74.8551%-141 - C2 -1SHB 3.9
101 PsiBlast_CBE 74.8050%-127 - C2 -1O4B 5.9
99 PsiBlast_CBE 74.7150%-143 - C2 -1O4E 3.5
122 PsiBlast_CBE 74.4150%-144 - C2 -1A09 5.7 SRC_HUMAN
93 PsiBlast_CBE 74.3750%-139 - C2 -1O4M 3.1
77 PsiBlast_CBE 74.1451%-152 - C2 -1P13 5.3 SRC_CHICK
124 PsiBlast_CBE 74.0150%-136 - C2 -1A08 5.6 SRC_HUMAN
97 PsiBlast_CBE 73.8850%-144 - C2 -1O4I 2.4
121 PsiBlast_CBE 73.8150%-145 - C2 -1A09 5.3
64 PsiBlast_CBE 73.8051%-148 - C2 -1IS0 2.5 SRC_RSVSA
78 PsiBlast_CBE 73.7251%-124 - C2 -1A1A 6.2
102 PsiBlast_CBE 73.6650%-130 - C2 -1O4A 7.0
104 PsiBlast_CBE 73.6050%-132 - C2 -1O48 8.4
70 PsiBlast_CBE 73.4851%-139 - C2 -1SHA 4.7
76 PsiBlast_CBE 73.4151%-150 - C2 -1P13 4.9
125 PsiBlast_CBE 73.3950%-134 - C2 -1A07 3.5
130 PsiBlast_CBE 73.3850%-137 - C2 -1O4G 4.2
114 PsiBlast_CBE 73.2650%-153 - C2 -1HCS 3.4
112 PsiBlast_CBE 73.2450%-166 - C2 -1SHD 6.1
94 PsiBlast_CBE 73.1850%-140 - C2 -1O4L 4.0
95 PsiBlast_CBE 73.1050%-144 - C2 -1O4K 3.5
106 PsiBlast_CBE 72.9850%-133 - C2 -1O46 8.2
107 PsiBlast_CBE 72.9350%-138 - C2 -1O45 7.3
85 PsiBlast_CBE 72.8851%-136 - C2 -1F1W 5.3
88 PsiBlast_CBE 72.7950%-142 - C2 -1O4R 5.5
118 PsiBlast_CBE 72.7750%-134 - C2 -1A1C 6.4 SRC_HUMAN
75 PsiBlast_CBE 72.6551%-147 - C2 -1SKJ 6.4
65 PsiBlast_CBE 72.5951%-133 - C2 -1SPS 5.2
123 PsiBlast_CBE 72.5650%-139 - C2 -1A08 6.2
63 PsiBlast_CBE 72.4851%-139 - C2 -1IS0 2.9
96 PsiBlast_CBE 72.4550%-138 - C2 -1O4J 2.9
100 PsiBlast_CBE 72.4250%-137 - C2 -1O4D 2.4
116 PsiBlast_CBE 72.3350%-151 - C2 -1A1E 6.3 SRC_HUMAN
131 PsiBlast_CBE 72.3150%-142 - C2 -1O4F 2.8
120 PsiBlast_CBE 72.2550%-136 - C2 -1A1B 5.9 SRC_HUMAN
110 PsiBlast_CBE 72.1250%-130 - C2 -1O42 7.4
90 PsiBlast_CBE 72.0750%-132 - C2 -1O4P 5.2
79 PsiBlast_CBE 72.0751%-128 - C2 -1A1A 4.5 SRC_HUMAN
109 PsiBlast_CBE 71.8750%-131 - C2 -1O43 6.4
89 PsiBlast_CBE 71.8250%-141 - C2 -1O4Q 3.5
119 PsiBlast_CBE 71.6650%-142 - C2 -1A1B 5.9
111 PsiBlast_CBE 71.4150%-140 - C2 -1O41 2.7
103 PsiBlast_CBE 71.3050%-131 - C2 -1O49 6.7
105 PsiBlast_CBE 71.2050%-128 - C2 -1O47 7.8
129 PsiBlast_CBE 71.0448%-159 - C2 -1KC2 5.9
117 PsiBlast_CBE 70.7250%-137 - C2 -1A1C 6.8
115 PsiBlast_CBE 70.1350%-135 - C2 -1A1E 6.5
66 PsiBlast_CBE 70.0751%-151 - C2 -1SPS 4.4 SRC_RSVSA
91 PsiBlast_CBE 69.5650%-129 - C2 -1O4O 3.0
57 PsiBlast_CBE 69.5060%-112 - C2 -1AOU 4.8
113 PsiBlast_CBE 69.0450%-133 - C2 -1HCT 3.2
58 PsiBlast_CBE 68.1860%-101 - C2 -1AOT 2.4
280 Fugue 66.1573% 56 - C2 -1LKK 7.0 LCK_HUMAN
59 PsiBlast_CBE 58.6160% -58 - C2 -4U17 2.1 ?
61 PsiBlast_CBE 56.8660% -58 - C2 -4U17 3.2 FYN_HUMAN