@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SH2B2_HUMAN: (2017-06-03 )
WFHGTLSRVKAAQLVLAGGPRNHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVLDMLRHF

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_B_3(1CSZ)

[Raw transfer]




CHAIN_J_10(2HDX)
SH2B1_MOUSE
[Raw transfer]

-

CHAIN_H_8(2HDX)
SH2B1_MOUSE
[Raw transfer]

-

CHAIN_I_9(2HDX)
SH2B1_MOUSE
[Raw transfer]

-

CHAIN_G_7(2HDX)
SH2B1_MOUSE
[Raw transfer]

-

CHAIN_L_12(2HDX)

[Raw transfer]

-

CHAIN_K_11(2HDX)
SH2B1_MOUSE
[Raw transfer]

-

25 PsiBlast_CBE 91.9976%-185 - C3 -2HDX 6.0 SH2B1_MOUSE
1 PsiBlast_PDB 91.3496%-156 - C3 -1RQQ Calc... SH2B2_RAT
21 PsiBlast_CBE 90.8576%-182 - C3 -2HDX 6.8
22 PsiBlast_CBE 90.2676%-182 - C3 -2HDX 5.9 SH2B1_MOUSE
4 PsiBlast_PDB 89.9676%-185 - C3 -2HDX 6.5 SH2B1_MOUSE
23 PsiBlast_CBE 88.0676%-180 - C3 -2HDX 5.2 SH2B1_MOUSE
24 PsiBlast_CBE 87.4676%-181 - C3 -2HDX 6.1 SH2B1_MOUSE
168 HHSearch 84.8177% 0 - C- -2HDV - SH2B1_MOUSE -
2 PsiBlast_PDB 84.3994%-150 - C3 -1RPY Calc... SH2B2_RAT
3 PsiBlast_PDB 84.1976% 0 - C- -2HDV - SH2B1_MOUSE -
31 PsiBlast_CBE 71.9631%-165 - C3 -1CSZ - -
32 PsiBlast_CBE 71.5831%-164 - C3 -1CSY - -
181 HHSearch 71.2029%-136 - C3 -1D4T Calc... SH21A_HUMAN
180 HHSearch 70.1226%-145 - C3 -1I3Z Calc... SH21B_MOUSE
179 HHSearch 69.3529%-137 - C3 -1KA6 Calc... SH21A_HUMAN
177 HHSearch 69.2429%-173 - C3 -3OV1 Calc... GRB2_HUMAN
38 PsiBlast_CBE 67.8831%-156 - C3 -1A81 - KSYK_HUMAN -
36 PsiBlast_CBE 67.6131%-150 - C3 -1A81 - KSYK_HUMAN -
35 PsiBlast_CBE 67.5731%-160 - C3 -1A81 - KSYK_HUMAN -
173 HHSearch 67.3426%-190 - C3 -2GSB Calc...
189 Fugue 56.7633% 36 - C3 -1CSZ Error