@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SLAP1_HUMAN: (2017-06-04 )
WLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHY

Atome Classification :

(39 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_I_3(1BHF)

[Raw transfer]




CC0_A_2(1IJR)
LCK_HUMAN
[Raw transfer]




PHS_B_3(1LCJ)
LCK_HUMAN
[Raw transfer]




PHS_B_4(1LKL)
?
[Raw transfer]




CC1_C_3(1FBZ)
LCK_HUMAN
[Raw transfer]




CHAIN_B_2(1CWE)
?
[Raw transfer]

-

CC1_D_4(1FBZ)
?
[Raw transfer]




CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_D_4(1CWE)
?
[Raw transfer]

-

CHAIN_P_2(1CWD)
?
[Raw transfer]

-

CHAIN_I_7(1X27)

[Raw transfer]

-

CHAIN_B_2(1LCJ)
LCK_HUMAN
[Raw transfer]

-

CHAIN_J_8(1X27)
?
[Raw transfer]

-

CHAIN_N_12(1X27)
?
[Raw transfer]

-

CHAIN_I_2(1BHF)

[Raw transfer]

-

CHAIN_L_10(1X27)
?
[Raw transfer]

-

CHAIN_K_9(1X27)
?
[Raw transfer]

-

ACE_B_3(1LKL)
?
[Raw transfer]




CHAIN_P_2(1AOT)

[Raw transfer]

-

CHAIN_M_11(1X27)
?
[Raw transfer]

-

CHAIN_B_2(1JU5)
CRK_HUMAN
[Raw transfer]

-

EDO_A_6(4U17)
?
[Raw transfer]




CHAIN_B_2(1LKL)
?
[Raw transfer]

-

EDO_A_6(4U17)
FYN_HUMAN
[Raw transfer]




CHAIN_B_2(1LCK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_P_2(1AOU)

[Raw transfer]

-

17 PsiBlast_PDB 83.3455% -60 - C2 -4LUD Calc... HCK_HUMAN
19 PsiBlast_PDB 82.6255% -36 - C2 -4U5W Calc... HCK_HUMAN
14 PsiBlast_PDB 81.8355% -55 - C2 -3VS5 Calc... HCK_HUMAN
8 PsiBlast_PDB 81.6555% -52 - C2 -3VRZ Calc... HCK_HUMAN
21 PsiBlast_CBE 81.5155% -47 - C2 -4LUE Calc... HCK_HUMAN
3 PsiBlast_PDB 81.4855% -35 - C2 -1QCF Calc... HCK_HUMAN
104 PsiBlast_CBE 81.1439% -38 - C2 -1O44 - -
16 PsiBlast_PDB 80.8755% -23 - C2 -3VS7 Calc... HCK_HUMAN
11 PsiBlast_PDB 80.7655% -65 - C2 -3VS2 Calc... HCK_HUMAN
44 PsiBlast_CBE 80.7549% -38 - C2 -4D8K Calc...
5 PsiBlast_PDB 80.6055% -23 - C2 -2C0O Calc... HCK_HUMAN
122 PsiBlast_CBE 80.5439% -35 - C2 -1A07 - SRC_HUMAN -
42 PsiBlast_CBE 80.5349% -36 - C2 -1LCJ 4.9 LCK_HUMAN
54 PsiBlast_CBE 80.1948% -50 - C2 -1IJR 8.1 LCK_HUMAN
100 PsiBlast_CBE 80.0239% -39 - C2 -1O48 - -
56 PsiBlast_CBE 79.9148% -50 - C2 -1FBZ 7.3 LCK_HUMAN
93 PsiBlast_CBE 79.9039% -44 - C2 -1O4I - -
12 PsiBlast_PDB 79.8255% -24 - C2 -3VS3 Calc... HCK_HUMAN
18 PsiBlast_PDB 79.7255% -42 - C2 -4LUE Calc... HCK_HUMAN
7 PsiBlast_PDB 79.7255% -49 - C2 -3VRY Calc... HCK_HUMAN
47 PsiBlast_CBE 78.7349% -40 - C2 -1X27 5.4 ?
53 PsiBlast_CBE 78.5949% -24 - C2 -1LKL 3.9 ?
55 PsiBlast_CBE 78.2048% -59 - C2 -1FBZ 7.3 ?
52 PsiBlast_CBE 78.1249% -31 - C2 -1X27 4.2
40 PsiBlast_CBE 78.1149% -39 - C2 -1CWE 6.1 ?
43 PsiBlast_CBE 77.0849% -40 - C2 -1BHF 5.3
46 PsiBlast_CBE 76.6249% -33 - C2 -1LKK 7.7 LCK_HUMAN
51 PsiBlast_CBE 76.4049% -38 - C2 -1X27 6.2 ?
39 PsiBlast_CBE 75.4749% -51 - C2 -1CWE 5.5 ?
41 PsiBlast_CBE 75.3449% -39 - C2 -1CWD 4.5 ?
49 PsiBlast_CBE 74.5149% -38 - C2 -1X27 5.7 ?
48 PsiBlast_CBE 73.6049% -28 - C2 -1X27 5.5 ?
50 PsiBlast_CBE 73.0749% -22 - C2 -1X27 4.5 ?
45 PsiBlast_CBE 72.7249% -32 - C2 -1LCK 4.4 LCK_HUMAN
57 PsiBlast_CBE 71.0648% -21 - C2 -1AOU 4.9
250 HHSearch 68.5235% -59 - C2 -1JU5 3.7 CRK_HUMAN
58 PsiBlast_CBE 67.6248% -14 - C2 -1AOT 1.7
61 PsiBlast_CBE 57.6248% -17 - C2 -4U17 3.0 FYN_HUMAN
59 PsiBlast_CBE 54.6648% -7 - C2 -4U17 2.1 ?