@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SLAP2_HUMAN: (2017-06-04 )
WLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHY

Atome Classification :

(84 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

UR2_A_2(1SKJ)

[Raw transfer]




CC0_A_2(1IJR)
LCK_HUMAN
[Raw transfer]




256_B_2(1O4Q)

[Raw transfer]




787_B_2(1O4R)

[Raw transfer]




687_B_2(1O45)

[Raw transfer]




843_B_2(1O42)

[Raw transfer]




OXD_B_2(1O4N)

[Raw transfer]




CIT_B_2(1O4L)

[Raw transfer]




772_B_2(1O4H)

[Raw transfer]




262_B_2(1O4D)

[Raw transfer]




791_B_2(1O4P)

[Raw transfer]




HPS_C_3(1O4O)

[Raw transfer]




299_B_2(1O4E)

[Raw transfer]




MLA_B_2(1O4M)

[Raw transfer]




I59_A_2(1O4G)

[Raw transfer]




PHS_B_4(1LKL)
?
[Raw transfer]




853_A_2(1O48)

[Raw transfer]




219_B_2(1O4I)

[Raw transfer]




PTC_C_5(1IS0)
SRC_RSVSA
[Raw transfer]




PSN_B_2(1O4K)

[Raw transfer]




903_B_2(1O46)

[Raw transfer]




PHS_B_3(1LCJ)
LCK_HUMAN
[Raw transfer]




821_B_2(1O43)

[Raw transfer]




300_B_2(1O41)

[Raw transfer]




IS2_A_2(1O4J)

[Raw transfer]




822_B_2(1O47)

[Raw transfer]




790_B_2(1O4F)

[Raw transfer]




CC1_D_4(1FBZ)
?
[Raw transfer]




CC1_C_3(1FBZ)
LCK_HUMAN
[Raw transfer]




CHAIN_I_2(1BHF)

[Raw transfer]

-

CHAIN_K_9(1X27)
?
[Raw transfer]

-

CHAIN_C_2(1A09)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A09)

[Raw transfer]

-

CHAIN_D_4(1A1A)

[Raw transfer]

-

CHAIN_D_4(1A1C)

[Raw transfer]

-

CHAIN_D_4(1A1B)

[Raw transfer]

-

CHAIN_J_8(1X27)
?
[Raw transfer]

-

CHAIN_C_3(1A1C)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_2(1A1B)
SRC_HUMAN
[Raw transfer]

-

CHAIN_B_2(1CWE)
?
[Raw transfer]

-

CHAIN_P_2(1CWD)
?
[Raw transfer]

-

CHAIN_N_12(1X27)
?
[Raw transfer]

-

CHAIN_C_3(1A1E)
SRC_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_M_11(1X27)
?
[Raw transfer]

-

CHAIN_C_2(1A1A)
SRC_HUMAN
[Raw transfer]

-

CHAIN_B_2(1KC2)

[Raw transfer]

-

ACE_D_6(1A1E)

[Raw transfer]




CHAIN_L_10(1X27)
?
[Raw transfer]

-

CHAIN_I_7(1X27)

[Raw transfer]

-

CHAIN_D_2(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_D_4(1CWE)
?
[Raw transfer]

-

CHAIN_B_2(1LCJ)
LCK_HUMAN
[Raw transfer]

-

ACE_D_6(1A08)

[Raw transfer]




CHAIN_B_2(1SHD)

[Raw transfer]

-

CHAIN_D_4(1A07)

[Raw transfer]

-

ACE_C_5(1A08)
SRC_HUMAN
[Raw transfer]




CHAIN_B_2(1SHB)

[Raw transfer]

-

ACE_C_5(1A1A)
SRC_HUMAN
[Raw transfer]




ACE_D_6(1A1A)

[Raw transfer]




CHAIN_D_4(1P13)
SRC_CHICK
[Raw transfer]

-

CHAIN_E_4(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_B_2(1LKL)
?
[Raw transfer]

-

CHAIN_F_6(1SPS)

[Raw transfer]

-

CHAIN_C_2(1A07)
SRC_HUMAN
[Raw transfer]

-

CHAIN_A_1(1HCS)

[Raw transfer]

-

CHAIN_A_1(1HCT)

[Raw transfer]

-

CHAIN_C_2(1IS0)
SRC_RSVSA
[Raw transfer]

-

EDO_A_6(4U17)
FYN_HUMAN
[Raw transfer]




CHAIN_C_3(1P13)

[Raw transfer]

-

CHAIN_P_2(1AOT)

[Raw transfer]

-

CHAIN_B_2(1LCK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1JU5)
CRK_HUMAN
[Raw transfer]

-

EDO_A_6(4U17)
?
[Raw transfer]




CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_P_2(1AOU)

[Raw transfer]

-

1 PsiBlast_PDB 81.59100% - - C- -4M4Z - SLAP2_HUMAN -
16 PsiBlast_PDB 78.5957%-149 - C2 -3VS6 - HCK_HUMAN -
50 PsiBlast_CBE 78.2954%-143 - C2 -1LKL 3.9 ?
13 PsiBlast_PDB 77.7657%-132 - C2 -3VS3 - HCK_HUMAN -
262 HHSearch 77.2554%-149 - C2 -4D8K - -
53 PsiBlast_CBE 77.2554%-149 - C2 -4D8K - -
261 HHSearch 77.1154%-143 - C2 -1LKK 6.7 LCK_HUMAN
51 PsiBlast_CBE 77.1154%-143 - C2 -1LKK 6.7 LCK_HUMAN
56 PsiBlast_CBE 76.1553%-161 - C2 -1IJR 8.3 LCK_HUMAN
6 PsiBlast_PDB 76.0957%-132 - C2 -2C0O - HCK_HUMAN -
2 PsiBlast_PDB 76.0857%-146 - C2 -3HCK - -
3 PsiBlast_PDB 76.0657%-160 - C2 -4U5W - HCK_HUMAN -
44 PsiBlast_CBE 75.9154%-147 - C2 -1X27 5.6 ?
49 PsiBlast_CBE 75.7854%-156 - C2 -1X27 4.2
42 PsiBlast_CBE 75.7354%-152 - C2 -1LCJ 4.7 LCK_HUMAN
46 PsiBlast_CBE 75.7054%-161 - C2 -1X27 5.5 ?
15 PsiBlast_PDB 75.6957%-149 - C2 -3VS5 - HCK_HUMAN -
17 PsiBlast_PDB 75.4657%-135 - C2 -3VS7 - HCK_HUMAN -
5 PsiBlast_PDB 75.3457%-148 - C2 -2C0I - HCK_HUMAN -
22 PsiBlast_CBE 75.3357%-140 - C2 -4LUE - HCK_HUMAN -
54 PsiBlast_CBE 75.2653%-169 - C2 -1FBZ 8.0 ?
47 PsiBlast_CBE 75.1554%-153 - C2 -1X27 4.5 ?
45 PsiBlast_CBE 74.6354%-143 - C2 -1X27 4.9 ?
55 PsiBlast_CBE 74.5853%-168 - C2 -1FBZ 6.7 LCK_HUMAN
48 PsiBlast_CBE 74.4254%-135 - C2 -1X27 6.7 ?
43 PsiBlast_CBE 74.0554%-150 - C2 -1BHF 5.2
52 PsiBlast_CBE 73.4854%-148 - C2 -1LCK 3.4 LCK_HUMAN
40 PsiBlast_CBE 72.6454%-157 - C2 -1CWE 5.9 ?
119 PsiBlast_CBE 72.6144%-154 - C2 -1A07 3.3
72 PsiBlast_CBE 72.1045%-159 - C2 -1IS0 4.8 SRC_RSVSA
41 PsiBlast_CBE 72.0354%-159 - C2 -1CWD 4.1 ?
80 PsiBlast_CBE 71.8745%-141 - C2 -1A1A 6.3
120 PsiBlast_CBE 71.8444%-163 - C2 -1A07 3.6 SRC_HUMAN
113 PsiBlast_CBE 71.3844%-158 - C2 -1A1B 6.1
69 PsiBlast_CBE 71.1045%-156 - C2 -1SHB 4.1
67 PsiBlast_CBE 71.1045%-144 - C2 -1SPS 5.7 SRC_RSVSA
116 PsiBlast_CBE 71.0844%-158 - C2 -1A09 5.7 SRC_HUMAN
115 PsiBlast_CBE 70.8744%-160 - C2 -1A09 6.3
114 PsiBlast_CBE 70.8044%-155 - C2 -1A1B 5.5 SRC_HUMAN
109 PsiBlast_CBE 70.7844%-152 - C2 -1A1E 3.3
118 PsiBlast_CBE 70.6844%-156 - C2 -1A08 3.4 SRC_HUMAN
39 PsiBlast_CBE 70.4354%-163 - C2 -1CWE 5.4 ?
81 PsiBlast_CBE 70.3545%-145 - C2 -1A1A 4.6 SRC_HUMAN
110 PsiBlast_CBE 69.3444%-167 - C2 -1A1E 6.6 SRC_HUMAN
108 PsiBlast_CBE 69.2044%-174 - C2 -1HCS 4.1
117 PsiBlast_CBE 69.1944%-155 - C2 -1A08 3.4
107 PsiBlast_CBE 69.1444%-156 - C2 -1HCT 3.0
112 PsiBlast_CBE 69.0744%-154 - C2 -1A1C 6.5 SRC_HUMAN
66 PsiBlast_CBE 69.0345%-168 - C2 -1SPS 4.7 SRC_RSVSA
103 PsiBlast_CBE 68.9644%-156 - C2 -1O43 6.4
111 PsiBlast_CBE 68.8744%-153 - C2 -1A1C 7.6
78 PsiBlast_CBE 68.8645%-168 - C2 -1P13 5.9 SRC_CHICK
85 PsiBlast_CBE 68.3844%-146 - C2 -1O4O 3.0
101 PsiBlast_CBE 67.9544%-155 - C2 -1O45 6.9
88 PsiBlast_CBE 67.9344%-158 - C2 -1O4L 3.9
87 PsiBlast_CBE 67.9144%-160 - C2 -1O4M 3.0
94 PsiBlast_CBE 67.8244%-155 - C2 -1O4D 2.9
64 PsiBlast_CBE 67.7245%-169 - C2 -1SKJ 6.4
105 PsiBlast_CBE 67.7144%-159 - C2 -1O41 3.2
84 PsiBlast_CBE 67.6744%-154 - C2 -1O4P 4.8
93 PsiBlast_CBE 67.5444%-160 - C2 -1O4E 3.5
86 PsiBlast_CBE 67.4044%-153 - C2 -1O4N 3.4
91 PsiBlast_CBE 67.3844%-161 - C2 -1O4I 2.2
65 PsiBlast_CBE 67.2845%-149 - C2 -1SPS 4.6
131 PsiBlast_CBE 67.2444%-160 - C2 -1O4F 2.5
90 PsiBlast_CBE 67.1444%-155 - C2 -1O4J 2.7
92 PsiBlast_CBE 67.0944%-156 - C2 -1O4H 3.7
89 PsiBlast_CBE 66.9244%-162 - C2 -1O4K 3.4
104 PsiBlast_CBE 66.9044%-152 - C2 -1O42 7.6
100 PsiBlast_CBE 66.9044%-153 - C2 -1O46 8.4
130 PsiBlast_CBE 66.7244%-157 - C2 -1O4G 3.9
79 PsiBlast_CBE 66.4245%-174 - C2 -1KC2 6.5
82 PsiBlast_CBE 66.3044%-162 - C2 -1O4R 5.4
106 PsiBlast_CBE 66.1044%-176 - C2 -1SHD 5.6
99 PsiBlast_CBE 66.0844%-149 - C2 -1O47 7.2
98 PsiBlast_CBE 65.9044%-152 - C2 -1O48 8.4
83 PsiBlast_CBE 65.8144%-158 - C2 -1O4Q 3.6
77 PsiBlast_CBE 65.8045%-171 - C2 -1P13 5.2
57 PsiBlast_CBE 61.9550%-126 - C2 -1AOU 4.9
58 PsiBlast_CBE 60.3050%-119 - C2 -1AOT 1.7
256 HHSearch 55.8241% -83 - C2 -1JU5 3.0 CRK_HUMAN
267 HHSearch 54.6533%-126 - C2 -3PQZ 2.9 GRB7_HUMAN
61 PsiBlast_CBE 52.8950% -77 - C2 -4U17 3.0 FYN_HUMAN
59 PsiBlast_CBE 52.5150% -75 - C2 -4U17 2.1 ?