@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SOCS6_HUMAN: (2017-06-04 )
WYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEH

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_5(2IZV)

[Raw transfer]



CHAIN_P_2(2VIF)
KIT_HUMAN
[Raw transfer]
-
CHAIN_P_2(2VIF)
KIT_HUMAN
[Raw transfer]
-
203 HHSearch 91.61100% -99 - C4 -2VIF 10.6 KIT_HUMAN
1 PsiBlast_PDB 91.61100% -99 - C4 -2VIF 10.6 KIT_HUMAN
19 PsiBlast_PDB 66.4838%-133 - C4 -4WAF - -
2 PsiBlast_PDB 65.7643% -84 - C4 -2IZV - -
204 HHSearch 64.1843% -83 - C4 -2IZV 3.4
21 PsiBlast_CBE 60.4934% -91 - C4 -4GL9 - SOCS3_MOUSE -
22 PsiBlast_CBE 60.3634% -96 - C4 -4GL9 - SOCS3_MOUSE -
7 PsiBlast_PDB 60.2834%-102 - C4 -4GL9 - SOCS3_MOUSE -
221 Fugue 59.8244% 4 - C4 -2IZV - -
29 PsiBlast_CBE 59.6132%-132 - C4 -2MC1 - -
13 PsiBlast_PDB 59.5738% -37 - C4 -2IUI - P85A_HUMAN -
208 HHSearch 58.9935%-152 - C- -3EAZ - CSK_HUMAN -
30 PsiBlast_CBE 58.9532%-127 - C4 -2LCT - -
211 HHSearch 58.7630%-165 - C4 -3US4 Calc...
24 PsiBlast_CBE 58.3338% -37 - C4 -2IUI - -
12 PsiBlast_PDB 58.2338% -38 - C4 -2IUH - KIT_HUMAN -
217 HHSearch 58.0539% -54 - C4 -4L23 Calc...
31 PsiBlast_CBE 57.9132%-134 - C4 -2ROR - -
214 HHSearch 57.7935%-107 - C4 -4EIH Calc...
206 HHSearch 57.7839% -31 - C4 -2IUG Calc...