@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SRC_HUMAN: (2017-06-04 )
WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYY

Atome Classification :

(89 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_A_4(1HCS)

[Raw transfer]




787_B_2(1O4R)

[Raw transfer]




852_B_2(1O44)

[Raw transfer]




791_B_2(1O4P)

[Raw transfer]




876_A_2(1O4B)

[Raw transfer]




843_B_2(1O42)

[Raw transfer]




256_B_2(1O4Q)

[Raw transfer]




CIT_B_2(1O4L)

[Raw transfer]




493_B_2(1O49)

[Raw transfer]




772_B_2(1O4H)

[Raw transfer]




OXD_B_2(1O4N)

[Raw transfer]




UR2_A_2(1SKJ)

[Raw transfer]




853_A_2(1O48)

[Raw transfer]




MLA_B_2(1O4M)

[Raw transfer]




687_B_2(1O45)

[Raw transfer]




CC0_A_2(1IJR)
LCK_HUMAN
[Raw transfer]




262_B_2(1O4D)

[Raw transfer]




1C5_A_2(1BKM)

[Raw transfer]




299_B_2(1O4E)

[Raw transfer]




HPS_C_3(1O4O)

[Raw transfer]




903_B_2(1O46)

[Raw transfer]




197_B_2(1O4A)

[Raw transfer]




I59_A_2(1O4G)

[Raw transfer]




PTC_C_5(1IS0)
SRC_RSVSA
[Raw transfer]




219_B_2(1O4I)

[Raw transfer]




821_B_2(1O43)

[Raw transfer]




PSN_B_2(1O4K)

[Raw transfer]




300_B_2(1O41)

[Raw transfer]




PTC_D_6(1IS0)

[Raw transfer]




IS2_A_2(1O4J)

[Raw transfer]




GOL_A_4(4D8K)

[Raw transfer]




GOL_A_4(4D8K)

[Raw transfer]




822_B_2(1O47)

[Raw transfer]




790_B_2(1O4F)

[Raw transfer]




CC1_D_4(1FBZ)
?
[Raw transfer]




CC1_C_3(1FBZ)
LCK_HUMAN
[Raw transfer]




CHAIN_I_2(1BHF)

[Raw transfer]

-

CHAIN_C_2(1A09)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_3(1A1C)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A09)

[Raw transfer]

-

CHAIN_D_4(1A1A)

[Raw transfer]

-

CHAIN_D_4(1A1E)

[Raw transfer]

-

CHAIN_D_4(1A1C)

[Raw transfer]

-

CHAIN_C_2(1A1B)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_3(1A1E)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_2(1A1A)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A1B)

[Raw transfer]

-

CHAIN_B_2(1SHA)

[Raw transfer]

-

CHAIN_C_2(1A08)
SRC_HUMAN
[Raw transfer]

-

CHAIN_K_9(1X27)
?
[Raw transfer]

-

CHAIN_D_4(1A08)

[Raw transfer]

-

CHAIN_A_1(1HCS)

[Raw transfer]

-

CHAIN_B_2(1KC2)

[Raw transfer]

-

CHAIN_B_2(1SHD)

[Raw transfer]

-

CHAIN_J_8(1X27)
?
[Raw transfer]

-

CHAIN_N_12(1X27)
?
[Raw transfer]

-

CHAIN_B_2(1CWE)
?
[Raw transfer]

-

CHAIN_A_1(1HCT)

[Raw transfer]

-

CHAIN_M_11(1X27)
?
[Raw transfer]

-

CHAIN_D_4(1A07)

[Raw transfer]

-

CHAIN_P_2(1CWD)
?
[Raw transfer]

-

CHAIN_D_2(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_B_2(1SHB)

[Raw transfer]

-

ACE_C_5(1A09)
SRC_HUMAN
[Raw transfer]




CHAIN_D_4(1P13)
SRC_CHICK
[Raw transfer]

-

CHAIN_B_2(1SHB)

[Raw transfer]

-

CHAIN_L_10(1X27)
?
[Raw transfer]

-

CHAIN_C_2(1IS0)
SRC_RSVSA
[Raw transfer]

-

CHAIN_B_2(1F1W)

[Raw transfer]

-

CHAIN_F_6(1SPS)

[Raw transfer]

-

CHAIN_C_2(1A07)
SRC_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_E_4(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_I_7(1X27)

[Raw transfer]

-

CHAIN_C_3(1P13)

[Raw transfer]

-

CHAIN_D_4(1CWE)
?
[Raw transfer]

-

CHAIN_D_4(1IS0)

[Raw transfer]

-

CHAIN_C_3(1NZV)

[Raw transfer]

-

EDO_A_6(4U17)
FYN_HUMAN
[Raw transfer]




CHAIN_C_3(1NZL)

[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LCJ)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKL)
?
[Raw transfer]

-

CHAIN_P_2(1AOT)

[Raw transfer]

-

EDO_A_6(4U17)
?
[Raw transfer]




CHAIN_B_2(1LCK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_P_2(1AOU)

[Raw transfer]

-

32 PsiBlast_CBE 92.19100%-136 - C1 -1HCT 3.3
33 PsiBlast_CBE 91.95100%-159 - C1 -1HCS 4.2
4 PsiBlast_PDB 89.76100%-145 - C1 -1KSW Calc... SRC_HUMAN
271 HHSearch 89.06100%-161 - C1 -2H8H Calc... SRC_HUMAN
1 PsiBlast_PDB 89.06100%-161 - C1 -2H8H - SRC_HUMAN -
29 PsiBlast_CBE 88.01100%-141 - C1 -1O4J 2.9
10 PsiBlast_PDB 87.93100%-139 - C1 -1O44 8.2
30 PsiBlast_CBE 87.88100%-149 - C1 -1O4I 2.0
3 PsiBlast_PDB 87.77100%-149 - C1 -2SRC Calc... SRC_HUMAN
26 PsiBlast_CBE 87.69100%-143 - C1 -1O4M 3.3
21 PsiBlast_CBE 87.62100%-147 - C1 -1O4R 5.9
54 PsiBlast_CBE 87.5397%-142 - C1 -1SHB 3.8
28 PsiBlast_CBE 87.45100%-149 - C1 -1O4K 3.4
6 PsiBlast_PDB 86.92100%-149 - C1 -4K11 Calc... SRC_HUMAN
57 PsiBlast_CBE 86.8797%-153 - C1 -1NZV 6.6
27 PsiBlast_CBE 86.81100%-143 - C1 -1O4L 4.1
19 PsiBlast_PDB 86.78100%-144 - C1 -1O4E 3.3
41 PsiBlast_CBE 86.77100%-148 - C1 -1A09 4.7 SRC_HUMAN
31 PsiBlast_CBE 86.56100%-166 - C1 -1SHD 6.8
55 PsiBlast_CBE 86.5597%-145 - C1 -1SHA 7.6
23 PsiBlast_CBE 86.54100%-134 - C1 -1O4P 5.1
48 PsiBlast_CBE 86.4897%-145 - C1 -1IS0 4.1
20 PsiBlast_PDB 86.43100%-144 - C1 -1O4H 3.3
17 PsiBlast_PDB 86.41100%-126 - C1 -1O4B 6.0
18 PsiBlast_PDB 86.37100%-139 - C1 -1O4D 2.5
62 PsiBlast_CBE 86.3697%-157 - C1 -1P13 5.4 SRC_CHICK
45 PsiBlast_CBE 86.28100%-144 - C1 -1A07 3.6 SRC_HUMAN
52 PsiBlast_CBE 86.2097%-133 - C1 -1SPS 5.4 SRC_RSVSA
14 PsiBlast_PDB 86.17100%-134 - C1 -1O48 8.3
7 PsiBlast_PDB 86.08100%-143 - C1 -1O41 2.4
35 PsiBlast_CBE 85.82100%-152 - C1 -1A1E 6.5 SRC_HUMAN
25 PsiBlast_CBE 85.69100%-142 - C1 -1O4N 3.4
69 PsiBlast_CBE 85.5498%-146 - C1 -1O4F 2.6
49 PsiBlast_CBE 85.4997%-151 - C1 -1IS0 4.6 SRC_RSVSA
43 PsiBlast_CBE 85.49100%-137 - C1 -1A08 5.7 SRC_HUMAN
44 PsiBlast_CBE 85.47100%-134 - C1 -1A07 3.6
8 PsiBlast_PDB 85.44100%-131 - C1 -1O42 7.5
65 PsiBlast_CBE 85.4396%-140 - C1 -1F1W 5.4
12 PsiBlast_PDB 85.29100%-136 - C1 -1O46 8.1
16 PsiBlast_PDB 85.28100%-132 - C1 -1O4A 6.2
22 PsiBlast_CBE 85.27100%-147 - C1 -1O4Q 3.4
51 PsiBlast_CBE 85.2197%-153 - C1 -1SPS 4.5 SRC_RSVSA
68 PsiBlast_CBE 85.0998%-139 - C1 -1O4G 3.6
11 PsiBlast_PDB 84.98100%-143 - C1 -1O45 6.2
59 PsiBlast_CBE 84.9197%-150 - C1 -1NZL 6.3
24 PsiBlast_CBE 84.89100%-134 - C1 -1O4O 3.4
40 PsiBlast_CBE 84.82100%-143 - C1 -1A09 4.9
39 PsiBlast_CBE 84.78100%-137 - C1 -1A1B 6.1 SRC_HUMAN
42 PsiBlast_CBE 84.66100%-143 - C1 -1A08 6.4
13 PsiBlast_PDB 84.63100%-130 - C1 -1O47 8.0
9 PsiBlast_PDB 84.62100%-135 - C1 -1O43 5.2
71 PsiBlast_CBE 84.2393%-159 - C1 -1KC2 6.4
46 PsiBlast_CBE 84.2398%-125 - C1 -1A1A 6.1
15 PsiBlast_PDB 83.94100%-132 - C1 -1O49 6.3
37 PsiBlast_CBE 83.42100%-132 - C1 -1A1C 6.7 SRC_HUMAN
36 PsiBlast_CBE 83.25100%-142 - C1 -1A1C 7.0
63 PsiBlast_CBE 83.2296%-150 - C1 -1BKM 7.0
61 PsiBlast_CBE 83.2197%-153 - C1 -1P13 5.3
47 PsiBlast_CBE 82.6198%-132 - C1 -1A1A 4.7 SRC_HUMAN
38 PsiBlast_CBE 82.54100%-143 - C1 -1A1B 5.8
34 PsiBlast_CBE 82.42100%-136 - C1 -1A1E 6.8
50 PsiBlast_CBE 82.3897%-136 - C1 -1SPS 5.2
56 PsiBlast_CBE 82.0297%-153 - C1 -1SKJ 6.7
285 Fugue 71.8897% 52 * C1 *1SHB 3.8
72 PsiBlast_CBE 71.8468%-110 - C1 -1AOU 2.4
114 PsiBlast_CBE 71.1654%-150 - C1 -1IJR 8.4 LCK_HUMAN
121 PsiBlast_CBE 68.4253%-145 - C1 -1X27 6.3 ?
73 PsiBlast_CBE 68.3368% -99 - C1 -1AOT 2.2
116 PsiBlast_CBE 66.7254%-151 - C1 -1FBZ 7.0 LCK_HUMAN
120 PsiBlast_CBE 66.1953%-123 - C1 -1X27 4.5 ?
122 PsiBlast_CBE 65.9953%-139 - C1 -1X27 3.4 ?
123 PsiBlast_CBE 65.2653%-119 - C1 -1X27 5.3 ?
128 PsiBlast_CBE 64.3853%-124 - C1 -1LKL 2.8 ?
124 PsiBlast_CBE 64.0253%-134 - C1 -1X27 3.6
273 HHSearch 64.0053%-127 - C1 -4D8K 3.3
118 PsiBlast_CBE 64.0053%-127 - C1 -4D8K 3.3
119 PsiBlast_CBE 63.8253%-132 - C1 -1X27 5.3 ?
125 PsiBlast_CBE 63.7453%-140 - C1 -1LCJ 4.3 LCK_HUMAN
270 HHSearch 63.4553%-128 - C1 -1LKK 7.0 LCK_HUMAN
127 PsiBlast_CBE 63.4553%-128 - C1 -1LKK 7.0 LCK_HUMAN
115 PsiBlast_CBE 63.3854%-155 - C1 -1FBZ 6.6 ?
126 PsiBlast_CBE 62.8953%-134 - C1 -1BHF 4.3
117 PsiBlast_CBE 62.4453%-130 - C1 -1LCK 3.3 LCK_HUMAN
130 PsiBlast_CBE 61.9453%-144 - C1 -1CWE 5.0 ?
131 PsiBlast_CBE 61.7853%-136 - C1 -1CWD 4.2 ?
129 PsiBlast_CBE 61.3453%-151 - C1 -1CWE 5.4 ?
276 HHSearch 56.1938%-107 - C1 -3PQZ 2.0 GRB7_HUMAN
75 PsiBlast_CBE 52.5668% -65 - C1 -4U17 2.8 ?
77 PsiBlast_CBE 49.7768% -65 - C1 -4U17 3.3 FYN_HUMAN