@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : VAV2_HUMAN: (2017-06-04 )
WFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_B_2(2MC1)

[Raw transfer]

-

CHAIN_B_2(2LNW)

[Raw transfer]

-

CHAIN_B_2(2LCT)

[Raw transfer]

-

CHAIN_B_2(2ROR)

[Raw transfer]

-

201 HHSearch 87.67100%-129 - C2 -2LNW Calc...
3 PsiBlast_PDB 87.67100%-129 - C2 -2LNW 2.5
213 HHSearch 86.11100%-122 - C2 -2DLZ Calc...
2 PsiBlast_PDB 86.11100%-122 - C2 -2DLZ - -
4 PsiBlast_PDB 86.10100%-141 - C2 -2LNX Calc... VAV2_HUMAN
204 HHSearch 84.73100% - - C- -4ROJ - VAV2_HUMAN -
1 PsiBlast_PDB 84.73100% - - C- -4ROJ - VAV2_HUMAN -
8 PsiBlast_PDB 70.2949%-134 - C2 -2ROR 4.8
6 PsiBlast_PDB 70.2849%-134 - C2 -2MC1 3.9
208 HHSearch 70.1449%-134 - C2 -2CRH Calc...
7 PsiBlast_PDB 70.1449%-134 - C2 -2CRH - -
5 PsiBlast_PDB 66.1549%-123 - C2 -2LCT 4.2
42 PsiBlast_CBE 65.9234%-122 - C2 -1R1S - GRAP2_MOUSE -
44 PsiBlast_CBE 64.3334%-123 - C2 -1R1Q - GRAP2_MOUSE -
205 HHSearch 63.8429%-180 - C2 -3US4 Calc...
71 PsiBlast_CBE 63.7835% -29 - C2 -3N8M - GRB2_HUMAN -
210 HHSearch 62.8428%-108 - C2 -4EIH Calc...
41 PsiBlast_CBE 62.6434%-119 - C2 -1R1S - GRAP2_MOUSE -
33 PsiBlast_CBE 62.6335% -28 - C2 -3MXY - GRB2_HUMAN -
45 PsiBlast_CBE 62.4534%-129 - C2 -1R1Q - GRAP2_MOUSE -