@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : YES_HUMAN: (2017-06-04 )
WYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHY

Atome Classification :

(91 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_A_4(1HCS)

[Raw transfer]




ACE_B_3(1CSZ)

[Raw transfer]




787_B_2(1O4R)

[Raw transfer]




876_A_2(1O4B)

[Raw transfer]




256_B_2(1O4Q)

[Raw transfer]




493_B_2(1O49)

[Raw transfer]




791_B_2(1O4P)

[Raw transfer]




852_B_2(1O44)

[Raw transfer]




CC0_A_2(1IJR)
LCK_HUMAN
[Raw transfer]




772_B_2(1O4H)

[Raw transfer]




CIT_B_2(1O4L)

[Raw transfer]




OXD_B_2(1O4N)

[Raw transfer]




UR2_A_2(1SKJ)

[Raw transfer]




687_B_2(1O45)

[Raw transfer]




843_B_2(1O42)

[Raw transfer]




MLA_B_2(1O4M)

[Raw transfer]




299_B_2(1O4E)

[Raw transfer]




262_B_2(1O4D)

[Raw transfer]




HPS_C_3(1O4O)

[Raw transfer]




853_A_2(1O48)

[Raw transfer]




I59_A_2(1O4G)

[Raw transfer]




1C5_A_2(1BKM)

[Raw transfer]




821_B_2(1O43)

[Raw transfer]




197_B_2(1O4A)

[Raw transfer]




903_B_2(1O46)

[Raw transfer]




PSN_B_2(1O4K)

[Raw transfer]




PTC_C_5(1IS0)
SRC_RSVSA
[Raw transfer]




219_B_2(1O4I)

[Raw transfer]




300_B_2(1O41)

[Raw transfer]




PTC_D_6(1IS0)

[Raw transfer]




IS2_A_2(1O4J)

[Raw transfer]




822_B_2(1O47)

[Raw transfer]




790_B_2(1O4F)

[Raw transfer]




CC1_D_4(1FBZ)
?
[Raw transfer]




CC1_C_3(1FBZ)
LCK_HUMAN
[Raw transfer]




CHAIN_I_2(1BHF)

[Raw transfer]

-

CHAIN_C_2(1A09)
SRC_HUMAN
[Raw transfer]

-

CHAIN_K_9(1X27)
?
[Raw transfer]

-

CHAIN_D_4(1A09)

[Raw transfer]

-

CHAIN_C_3(1A1C)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A1A)

[Raw transfer]

-

CHAIN_C_2(1A1B)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A1C)

[Raw transfer]

-

CHAIN_D_4(1A1E)

[Raw transfer]

-

CHAIN_D_4(1A1B)

[Raw transfer]

-

CHAIN_B_2(1SHA)

[Raw transfer]

-

CHAIN_J_8(1X27)
?
[Raw transfer]

-

CHAIN_B_2(1CWE)
?
[Raw transfer]

-

CHAIN_N_12(1X27)
?
[Raw transfer]

-

CHAIN_C_3(1A1E)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_2(1A08)
SRC_HUMAN
[Raw transfer]

-

CHAIN_P_2(1CWD)
?
[Raw transfer]

-

CHAIN_D_4(1A08)

[Raw transfer]

-

CHAIN_M_11(1X27)
?
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_C_2(1A1A)
SRC_HUMAN
[Raw transfer]

-

CHAIN_B_2(1KC2)

[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_D_4(1CWE)
?
[Raw transfer]

-

CHAIN_B_2(1SHD)

[Raw transfer]

-

EDO_A_6(4U17)
FYN_HUMAN
[Raw transfer]




CHAIN_I_7(1X27)

[Raw transfer]

-

CHAIN_L_10(1X27)
?
[Raw transfer]

-

CHAIN_D_4(1A07)

[Raw transfer]

-

CHAIN_A_1(1HCT)

[Raw transfer]

-

ACE_C_5(1A1A)
SRC_HUMAN
[Raw transfer]




CHAIN_B_2(1SHB)

[Raw transfer]

-

EDO_A_6(4U17)
?
[Raw transfer]




CHAIN_F_6(1SPS)

[Raw transfer]

-

CHAIN_D_4(1P13)
SRC_CHICK
[Raw transfer]

-

CHAIN_B_2(1LCJ)
LCK_HUMAN
[Raw transfer]

-

CHAIN_A_1(1HCS)

[Raw transfer]

-

CHAIN_B_2(1F1W)

[Raw transfer]

-

CHAIN_P_2(1AOT)

[Raw transfer]

-

CHAIN_E_4(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_C_2(1IS0)
SRC_RSVSA
[Raw transfer]

-

CHAIN_B_2(1LKL)
?
[Raw transfer]

-

CHAIN_C_3(1P13)

[Raw transfer]

-

CHAIN_C_2(1A07)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1IS0)

[Raw transfer]

-

CHAIN_B_2(1LCK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_C_3(1NZV)

[Raw transfer]

-

CHAIN_C_3(1NZL)

[Raw transfer]

-

CHAIN_P_2(1AOU)

[Raw transfer]

-

CHAIN_P_2(1AOU)

[Raw transfer]

-

CHAIN_F_6(1SPS)
SRC_RSVSA
[Raw transfer]

-

4 PsiBlast_PDB 88.0283%-102 - C3 -2MRJ Calc... FYN_HUMAN
268 HHSearch 86.1883%-101 - C3 -4U1P Calc... FYN_HUMAN
8 PsiBlast_PDB 86.1883%-101 - C3 -4U1P - FYN_HUMAN -
6 PsiBlast_PDB 85.2183% -95 - C3 -2MQI Calc... FYN_HUMAN
9 PsiBlast_PDB 84.9283%-104 - C3 -3UF4 Calc... FYN_MOUSE
3 PsiBlast_PDB 84.4283%-115 - C3 -1G83 Calc... FYN_HUMAN
7 PsiBlast_PDB 83.2383% -98 - C3 -2MRK Calc... FYN_HUMAN
26 PsiBlast_CBE 83.1869%-135 - C3 -1NZV 6.0
2 PsiBlast_PDB 82.4883% -95 - C3 -1AOU 4.7
128 PsiBlast_CBE 81.7260%-132 - C3 -1X27 6.0 ?
11 PsiBlast_PDB 81.6369%-123 - C3 -1SHB 3.8
275 HHSearch 81.1969%-143 * C3 *2H8H Calc... SRC_HUMAN
27 PsiBlast_CBE 81.0669%-131 - C3 -1NZL 6.6
31 PsiBlast_CBE 80.9568%-131 - C3 -1BKM 6.6
10 PsiBlast_PDB 80.9569%-127 - C3 -1SHA 7.2
129 PsiBlast_CBE 80.8960%-124 - C3 -1X27 3.3 ?
45 PsiBlast_CBE 80.5768%-123 - C3 -1O4D 2.4
12 PsiBlast_PDB 80.4869%-133 - C3 -1SPR Calc... SRC_RSVSA
62 PsiBlast_CBE 80.2068%-114 - C3 -1HCT 2.9
65 PsiBlast_CBE 80.1668%-132 - C3 -1A1E 6.3 SRC_HUMAN
19 PsiBlast_PDB 80.0669%-144 - C3 -1P13 5.4 SRC_CHICK
78 PsiBlast_CBE 79.9766%-143 - C3 -1KC2 6.1
63 PsiBlast_CBE 79.9368%-135 - C3 -1HCS 3.9
35 PsiBlast_CBE 79.9368%-116 - C3 -1O4P 5.2
44 PsiBlast_CBE 79.9068%-128 - C3 -1O4E 3.4
135 PsiBlast_CBE 79.8959%-130 - C3 -1IJR 8.2 LCK_HUMAN
28 PsiBlast_CBE 79.8369%-139 - C3 -1P13 5.1
53 PsiBlast_CBE 79.6768%-121 - C3 -1O44 8.4
39 PsiBlast_CBE 79.6368%-127 - C3 -1O4L 3.9
1 PsiBlast_PDB 79.5683% -83 - C3 -1AOT 2.1
13 PsiBlast_PDB 79.5569%-115 - C3 -1SPS 2.5 SRC_RSVSA
127 PsiBlast_CBE 79.5360%-111 - C3 -1X27 4.5 ?
61 PsiBlast_CBE 79.4368%-148 - C3 -1SHD 6.2
38 PsiBlast_CBE 79.4168%-125 - C3 -1O4M 3.1
33 PsiBlast_CBE 79.3968%-130 - C3 -1O4R 5.7
120 PsiBlast_CBE 79.3260%-124 - C3 -1LCJ 4.7 LCK_HUMAN
41 PsiBlast_CBE 79.2668%-124 - C3 -1O4J 2.8
42 PsiBlast_CBE 79.2068%-131 - C3 -1O4I 2.4
74 PsiBlast_CBE 79.1968%-118 - C3 -1A07 3.5
30 PsiBlast_CBE 79.1669%-114 - C3 -1A1A 4.5 SRC_HUMAN
14 PsiBlast_PDB 79.1569%-133 - C3 -1IS0 4.7 SRC_RSVSA
77 PsiBlast_CBE 79.0768%-126 - C3 -1F1W 6.1
81 PsiBlast_CBE 79.0168%-123 - C3 -1O4G 3.8
71 PsiBlast_CBE 78.9868%-130 - C3 -1A09 5.8 SRC_HUMAN
37 PsiBlast_CBE 78.9368%-124 - C3 -1O4N 3.4
67 PsiBlast_CBE 78.8668%-119 - C3 -1A1C 6.5 SRC_HUMAN
134 PsiBlast_CBE 78.7560%-123 - C3 -1CWD 4.1 ?
49 PsiBlast_CBE 78.7168%-117 - C3 -1O48 8.4
130 PsiBlast_CBE 78.7060%-105 - C3 -1X27 5.9 ?
48 PsiBlast_CBE 78.6468%-115 - C3 -1O49 6.6
25 PsiBlast_CBE 78.6469%-124 - C3 -1IS0 4.1
82 PsiBlast_CBE 78.3968%-128 - C3 -1O4F 2.5
126 PsiBlast_CBE 78.3860%-115 - C3 -1X27 5.4 ?
137 PsiBlast_CBE 78.2959%-137 - C3 -1FBZ 6.8 LCK_HUMAN
123 PsiBlast_CBE 78.2760%-110 - C3 -1LKL 3.0 ?
121 PsiBlast_CBE 78.2460%-117 - C3 -1BHF 4.8
23 PsiBlast_CBE 78.1869%-118 - C3 -1SPS 5.2
47 PsiBlast_CBE 78.1468%-117 - C3 -1O4A 7.1
46 PsiBlast_CBE 78.1168%-112 - C3 -1O4B 5.9
51 PsiBlast_CBE 78.0668%-119 - C3 -1O46 7.9
73 PsiBlast_CBE 78.0268%-121 - C3 -1A08 5.7 SRC_HUMAN
75 PsiBlast_CBE 77.9268%-126 - C3 -1A07 3.4 SRC_HUMAN
56 PsiBlast_CBE 77.8668%-128 - C3 -1O41 2.7
125 PsiBlast_CBE 77.7460%-112 - C3 -1LCK 3.0 LCK_HUMAN
34 PsiBlast_CBE 77.7068%-128 - C3 -1O4Q 3.5
43 PsiBlast_CBE 77.5968%-125 - C3 -1O4H 3.7
131 PsiBlast_CBE 77.4860%-119 - C3 -1X27 4.0
52 PsiBlast_CBE 77.3168%-127 - C3 -1O45 7.3
133 PsiBlast_CBE 77.2760%-126 - C3 -1CWE 5.1 ?
136 PsiBlast_CBE 77.2359%-138 - C3 -1FBZ 6.6 ?
267 HHSearch 77.0860%-112 - C3 -1LKK 7.2 LCK_HUMAN
122 PsiBlast_CBE 77.0860%-112 - C3 -1LKK 7.2 LCK_HUMAN
132 PsiBlast_CBE 77.0660%-137 - C3 -1CWE 5.2 ?
40 PsiBlast_CBE 77.0568%-131 - C3 -1O4K 3.5
29 PsiBlast_CBE 76.9869%-108 - C3 -1A1A 6.3
69 PsiBlast_CBE 76.8768%-121 - C3 -1A1B 5.9 SRC_HUMAN
54 PsiBlast_CBE 76.8368%-120 - C3 -1O43 6.4
50 PsiBlast_CBE 76.7268%-112 - C3 -1O47 7.9
68 PsiBlast_CBE 76.3968%-123 - C3 -1A1B 5.9
24 PsiBlast_CBE 76.3369%-138 - C3 -1SPS 4.5 SRC_RSVSA
16 PsiBlast_PDB 76.0669%-135 - C3 -1SKJ 6.9
66 PsiBlast_CBE 76.0468%-119 - C3 -1A1C 6.9
55 PsiBlast_CBE 75.9968%-115 - C3 -1O42 7.4
72 PsiBlast_CBE 75.9068%-120 - C3 -1A08 6.4
70 PsiBlast_CBE 75.6968%-126 - C3 -1A09 5.6
36 PsiBlast_CBE 74.7868%-115 - C3 -1O4O 3.0
64 PsiBlast_CBE 74.5868%-115 - C3 -1A1E 6.7
21 PsiBlast_CBE 71.5483% -46 - C3 -4U17 2.9 ?
5 PsiBlast_PDB 70.2683% -46 - C3 -4U17 2.3 FYN_HUMAN
284 Fugue 68.1483% 119 - C3 -1AOU 4.7
259 PsiBlast_CBE 63.6333%-169 - C3 -1CSZ Error