@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : ZAP70_HUMAN: (2017-06-04 )
WYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYL

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_B_3(1LKK)
LCK_HUMAN
[Raw transfer]




ACE_B_3(1LKK)
LCK_HUMAN
[Raw transfer]




ACE_I_3(1BHF)

[Raw transfer]




ACE_B_3(1CSZ)

[Raw transfer]




ACE_B_3(1CSZ)

[Raw transfer]




ACE_B_3(1LKL)
?
[Raw transfer]




NH2_B_4(1CSY)

[Raw transfer]




CHAIN_H_8(1A81)
KSYK_HUMAN
[Raw transfer]

-

CHAIN_J_10(1A81)
KSYK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1CSZ)

[Raw transfer]

-

CHAIN_B_2(1CSY)

[Raw transfer]

-

CHAIN_B_2(2OQ1)
ZAP70_HUMAN
[Raw transfer]

-

CHAIN_F_6(1A81)
KSYK_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A81)
KSYK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1A81)
KSYK_HUMAN
[Raw transfer]

-

CHAIN_L_12(1A81)
KSYK_HUMAN
[Raw transfer]

-

277 HHSearch 100.00100% 0 - C- -2OZO - ZAP70_HUMAN -
2 PsiBlast_PDB 100.00100% 0 - C- -4K2R - ZAP70_HUMAN -
1 PsiBlast_PDB 100.00100% 0 - C- -2OZO - ZAP70_HUMAN -
6 PsiBlast_PDB 96.64100%-152 - C2 -2OQ1 6.3 ZAP70_HUMAN
5 PsiBlast_PDB 95.43100%-156 - C2 -1M61 Calc... ZAP70_HUMAN
4 PsiBlast_PDB 95.19100%-162 - C2 -4XZ0 Calc... ZAP70_HUMAN
3 PsiBlast_PDB 94.99100%-161 - C2 -4XZ1 Calc... ZAP70_HUMAN
8 PsiBlast_PDB 73.4653%-158 - C2 -1CSZ 3.8
25 PsiBlast_CBE 73.0553%-143 - C2 -1A81 4.9 KSYK_HUMAN
22 PsiBlast_CBE 72.3853%-137 - C2 -1A81 5.3 KSYK_HUMAN
9 PsiBlast_PDB 72.1653%-160 - C2 -1A81 4.5 KSYK_HUMAN
24 PsiBlast_CBE 72.0353%-153 - C2 -1A81 4.0 KSYK_HUMAN
7 PsiBlast_PDB 69.9853%-159 - C2 -1CSY 3.3
21 PsiBlast_CBE 69.8953%-152 - C2 -1A81 4.1 KSYK_HUMAN
23 PsiBlast_CBE 69.6653%-148 - C2 -1A81 5.3 KSYK_HUMAN
15 PsiBlast_PDB 68.9236%-152 - C2 -5EG3 - ? -
286 HHSearch 67.1434% -69 - C2 -2EO3 Calc... CRKL_HUMAN
284 HHSearch 65.4337%-116 - C2 -1I3Z Calc... SH21B_MOUSE
245 PsiBlast_CBE 65.0938% -75 - C2 -4NWG - PTN11_HUMAN -
17 PsiBlast_PDB 64.4736%-155 - C2 -4K45 - PLCG1_RAT -
287 HHSearch 54.0634% 9 - C2 -1LKK Error LCK_HUMAN
257 PsiBlast_CBE 51.8131% 10 - C2 -1LKK Error LCK_HUMAN
256 PsiBlast_CBE 50.1831% 18 - C2 -1LKL 3.4 ?
255 PsiBlast_CBE 48.4431% 7 - C2 -1BHF Error
293 Fugue 46.4050% 78 - C2 -1CSZ Error