@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr0005: (2017-12-13 )
MTKLLVGLGNPGDKYFETKHNVGFMLIDQLAKKQNVTFTHDKIFQADLASFFLNGEKIYLVKPTTFMNESGKAVHALLTYYGLDIDDLLIIYDDLDMEVGKIRLRAKGSAGGHNGIKSIIQHIGTQVFNRVKIGIGRPKNGMSVVHHVLSKFDRDDYIGILQSIDKVDDSVNYYLQEKKFEKTMQRYNG

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_9(4IKO)
?
[Raw transfer]




GOL_A_9(4JY7)
?
[Raw transfer]




0L1_A_3(4DHW)
PTH_PSEAE
[Raw transfer]




0L1_B_4(4DHW)
PTH_PSEAE
[Raw transfer]




0L1_B_4(4DHW)
PTH_PSEAE
[Raw transfer]




PML_B_4(4DJJ)
PTH_PSEAE
[Raw transfer]




3NZ_A_3(4QBK)
PTH_PSEAE
[Raw transfer]




GOL_A_3(4QD3)
PTH_PSEAE
[Raw transfer]




PEG_B_4(4ERX)
PTH_PSEAE
[Raw transfer]




5AE_A_2(4QD3)
PTH_PSEAE
[Raw transfer]




PML_A_3(4DJJ)
PTH_PSEAE
[Raw transfer]




PEG_A_3(4ERX)
PTH_PSEAE
[Raw transfer]




URI_A_2(4JX9)
?
[Raw transfer]




CTN_A_2(4JWK)
?
[Raw transfer]




EDO_A_4(3NEA)
PTH_FRATT
[Raw transfer]




TLA_A_3(4OLJ)
?
[Raw transfer]




71 Fugue 92.5864%-115 - C6 -4QT4 - PTH_STRPZ -
1 PsiBlast_PDB 92.5864%-115 - C6 -4QT4 - PTH_STRPZ -
57 HHSearch 86.2041%-117 - C6 -4YLY - PTH_STAAU -
2 PsiBlast_PDB 85.8041%-126 - C6 -4YLY - PTH_STAAU -
21 PsiBlast_CBE 85.6241%-123 - C6 -4YLY - PTH_STAAU -
63 HHSearch 84.7736%-125 - C6 -3NEA 3.0 PTH_FRATT
16 PsiBlast_PDB 83.9737%-115 - C6 -3NEA - PTH_FRATT -
26 PsiBlast_CBE 83.8536%-113 - C6 -4JWK 3.5 ?
31 PsiBlast_CBE 83.6136%-112 - C6 -4OLJ 2.7 ?
27 PsiBlast_CBE 83.2736%-114 - C6 -4IKO Error ?
22 PsiBlast_CBE 83.2436%-109 - C6 -4LWR - ? -
24 PsiBlast_CBE 83.0736%-114 - C6 -4JY7 Error ?
20 PsiBlast_PDB 82.9836%-109 - C6 -4LWQ - ? -
25 PsiBlast_CBE 82.9036%-108 - C6 -4JX9 4.1 ?
62 HHSearch 82.8737%-108 - C6 -4LWR - ? -
30 PsiBlast_CBE 82.6836%-115 - C6 -4FOP - ? -
23 PsiBlast_CBE 82.6336%-109 - C6 -3WH4 - ? -
28 PsiBlast_CBE 82.5136%-113 - C6 -4HOY - ? -
58 HHSearch 82.0037%-110 * C6 *4HOY - ? -
29 PsiBlast_CBE 81.8636%-113 - C6 -4FOT - ? -
54 HHSearch 80.2034% -72 - C6 -4DHW 3.1 PTH_PSEAE
43 PsiBlast_CBE 75.6837% -82 - C6 -4DHW 3.1 PTH_PSEAE
40 PsiBlast_CBE 74.7837% -82 - C6 -4ERX 3.0 PTH_PSEAE
39 PsiBlast_CBE 74.3037% -78 - C6 -4ERX 2.0 PTH_PSEAE
41 PsiBlast_CBE 74.2837% -79 - C6 -4DJJ 3.5 PTH_PSEAE
44 PsiBlast_CBE 74.1537% -80 - C6 -4DHW 2.8 PTH_PSEAE
42 PsiBlast_CBE 73.4837% -82 - C6 -4DJJ 2.9 PTH_PSEAE
34 PsiBlast_CBE 73.2537% -77 - C6 -4QD3 3.6 PTH_PSEAE
35 PsiBlast_CBE 73.0037% -76 - C6 -4QBK 6.4 PTH_PSEAE