@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr0025: (2017-12-13 )
MEEVEVAEVKNARVSLTGEKTKPMKLAEVTSINVNRTKTEMEEFNRVLGGGVVPGSLVLIGGDPGIGKSTLLLQVSTQLSQVGTVLYVSGEESAQQIKLRAERLGDIDSEFYLYAETNMQSVRAEVERIQPDFLIIDSIQTIMSPEISGVQGSVSQVREVTAELMQLAKTNNIAIFIVGHVTKEGTLAGPRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPTMFGNAKRTTTGLDFNRASLIMAVLEKRAGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKNSLTGITLPKEIQVIGVTTIQEVLKKVFA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TYD_B_6(5LKM)
?
[Raw transfer]




TYD_C_8(5LKM)
?
[Raw transfer]




TYD_C_8(5LKM)
?
[Raw transfer]




TYD_A_4(5LKM)
?
[Raw transfer]




TYD_A_4(5LKM)
?
[Raw transfer]




1 PsiBlast_PDB 94.7999%-124 * C1 *5LKM 6.5 ?
31 HHSearch 94.66100%-124 - C1 -5LKM 6.5 ?
30 HHSearch 92.65100%-127 - C1 -5LKM 5.5 ?
21 PsiBlast_CBE 92.4599%-127 - C1 -5LKM 5.5 ?
22 PsiBlast_CBE 92.1399%-142 - C1 -5LKM 5.7 ?
2 PsiBlast_PDB 64.26100%-133 - C1 -5LKQ - ? -
33 HHSearch 63.6994%-133 - C1 -5LKQ - ? -
32 HHSearch 63.0994%-132 - C1 -5LKQ - ? -
35 HHSearch 52.7840%-129 - C1 -5H45 - ? -
34 HHSearch 52.4040%-123 - C1 -5H45 - ? -
3 PsiBlast_PDB 51.9242%-129 - C1 -5H45 - ? -
11 PsiBlast_PDB 35.9826% -36 - C1 -1XHK - LONB_METJA -
14 PsiBlast_PDB 35.1828% -76 - C1 -4YPM - ? -
17 PsiBlast_PDB 34.5527%-134 - C1 -5G4F - VAT_THEAC -
13 PsiBlast_PDB 34.4128% -77 - C1 -5E7S - ? -
5 PsiBlast_PDB 34.1730% 15 - C1 -1Z0G - LONB_ARCFU -
49 HHSearch 34.0418% -25 - C1 -3LDA - RAD51_YEAST -
7 PsiBlast_PDB 33.9530% 10 - C1 -1Z0V - LONB_ARCFU -
6 PsiBlast_PDB 33.5130% 14 - C1 -1Z0T - LONB_ARCFU -
4 PsiBlast_PDB 32.9030% 13 - C1 -1Z0E - LONB_ARCFU -