@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr0028: (2017-12-13 )
MSFSDLKLFALSSNKELAERVAQEIGIELGKSSVRQFSDGEIQVNIEESIRGKHVFILQSTSSPVNDNLLEILIMVDALKRASAESVNVVMPYYGYARQDRKARAREPITSKLVANMLEVAGVDRLLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFERRGMVGSDYVVVSPDHGGVTRARKLAEFLKTSIAIIDKRRSVDKMNTSEVMNIIGKVEGKTCILIDDMIDTAGTICHAADALAEAGAVEVYASCTHPVLSGPATDNIQKSAIKKLVVLDTIYLPEERLIDKIEQISIAHLLGDAIVRIHEKRPLSPLFDIEKKI

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AMP_B_13(3DAH)
?
[Raw transfer]




ABM_F_6(1DKU)
KPRS_BACSU
[Raw transfer]




AMP_B_13(3DAH)
?
[Raw transfer]




AMP_B_12(2HCR)
PRPS1_HUMAN
[Raw transfer]




AMP_A_11(2HCR)
PRPS1_HUMAN
[Raw transfer]




AMP_A_11(3DAH)
?
[Raw transfer]




AMP_B_12(3DAH)
?
[Raw transfer]




AMP_B_12(3DAH)
?
[Raw transfer]




ADP_A_7(3LRT)
KPRS_THEVO
[Raw transfer]




ADP_A_8(3MBI)
KPRS_THEVO
[Raw transfer]




ABM_E_5(1DKU)
KPRS_BACSU
[Raw transfer]




ABM_E_5(1DKU)
KPRS_BACSU
[Raw transfer]




ABM_E_5(1DKU)
KPRS_BACSU
[Raw transfer]




50 Fugue 95.0364%-175 - C5 -1DKU 2.9 KPRS_BACSU
62 HHSearch 94.5063%-173 - C5 -1DKR - KPRS_BACSU -
21 PsiBlast_CBE 93.7063%-175 - C5 -1DKU 3.1 KPRS_BACSU
1 PsiBlast_PDB 93.6963%-175 - C5 -1DKU 2.9 KPRS_BACSU
63 HHSearch 93.5563%-175 - C5 -1DKU 2.9 KPRS_BACSU
7 PsiBlast_PDB 89.8445%-161 - C5 -4LYG - PRPS1_HUMAN -
10 PsiBlast_PDB 88.2145%-158 - C5 -3EFH - PRPS1_HUMAN -
14 PsiBlast_PDB 87.1345%-153 - C5 -4M0P - PRPS1_HUMAN -
11 PsiBlast_PDB 86.6145%-156 - C5 -3S5J - PRPS1_HUMAN -
15 PsiBlast_PDB 86.5045%-156 - C5 -4M0U - PRPS1_HUMAN -
9 PsiBlast_PDB 86.2045%-156 - C5 -2HCR 4.2 PRPS1_HUMAN
12 PsiBlast_PDB 86.0645%-153 - C5 -4LZO - PRPS1_HUMAN -
13 PsiBlast_PDB 85.9545%-154 - C5 -4LZN - PRPS1_HUMAN -
8 PsiBlast_PDB 85.8845%-152 - C5 -2H06 - PRPS1_HUMAN -
6 PsiBlast_PDB 85.5845%-154 - C5 -2H07 - PRPS1_HUMAN -
5 PsiBlast_PDB 85.5445%-153 - C5 -2H08 - PRPS1_HUMAN -
4 PsiBlast_PDB 85.4745%-153 - C5 -4F8E - PRPS1_HUMAN -
31 PsiBlast_CBE 85.1645%-155 - C5 -2HCR 3.0 PRPS1_HUMAN
38 PsiBlast_CBE 84.5545%-148 - C5 -5T3O - ? -
16 PsiBlast_PDB 84.1645%-152 - C5 -5T3O - ? -
69 HHSearch 81.1855% -59 - C5 -3DAH 3.1 ?
23 PsiBlast_CBE 80.7354% -58 - C5 -3DAH 3.1 ?
70 HHSearch 79.1655% -63 - C5 -3DAH 3.7 ?
24 PsiBlast_CBE 77.9654% -61 - C5 -3DAH 3.7 ?
2 PsiBlast_PDB 77.7554% -68 - C5 -3DAH 4.0 ?