@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr0096: (2017-12-15 )
MKSITKKIKATLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLSEIAETHNTTVEKLAENNHIDNIHLIYVDQELVIDGPVAPVATPAPATYAAPAAQDETVSAPVAETPVVSETVVSTVSGSEAEAKEWIAQKESGGSYTATNGRYIGRYGSWTAAKNFWLNNGWY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAG_B_4(5C8Q)
?
[Raw transfer]




NAG_B_5(5C8Q)
?
[Raw transfer]




EDO_A_9(4OW1)
RPFC_MYCTU
[Raw transfer]




49 Fugue 74.0621% -75 - C4 -2MPW - EAE_ECO27 -
4 PsiBlast_PDB 72.7537%-184 - C4 -5C8Q - ? -
29 HHSearch 71.6738%-180 - C4 -5C8Q 3.3 ?
3 PsiBlast_PDB 71.3337%-175 - C4 -5C8P - ? -
21 PsiBlast_CBE 67.9745%-216 - C4 -4UZ3 - ? -
8 PsiBlast_PDB 67.5245%-216 - C4 -4UZ3 - ? -
44 Fugue 66.1537%-123 - C4 -2MKX - -
2 PsiBlast_PDB 65.9837%-142 - C- -5C8O - ? -
20 PsiBlast_PDB 65.6135% -88 - C4 -1Y7M - YKUD_BACSU -
28 HHSearch 64.7935% -96 - C4 -2L9Y - ? -
32 HHSearch 63.6631%-190 - C4 -4B8V - ? -
10 PsiBlast_PDB 62.4641% -37 - C4 -4B9H - ? -
9 PsiBlast_PDB 62.2141% -39 - C4 -4B8V - ? -
5 PsiBlast_PDB 62.0444%-180 - C4 -2MKX - -
13 PsiBlast_PDB 61.8130%-201 - C4 -4S3K - ? -
11 PsiBlast_PDB 61.7029%-168 - C4 -4S3J - ? -
35 HHSearch 60.8628%-131 * C4 *5JCD - CEBIP_ORYSJ -
6 PsiBlast_PDB 60.4536%-105 - C4 -2L9Y - ? -
43 Fugue 60.4427%-132 - C4 -1E0G - -
30 HHSearch 59.1737% 59 - C4 -5FIM - YGAU_ECOLI -