@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr0101: (2017-12-15 )
MKKVLMTMFGLVMLPLLFACSNNQSAGIEAIKSKGKLVVALNPDFAPFEYQKVVDGKNQIVGSDIELAKAIATELGVELELSPMSFDNVLASVQSGKADLAISGVSKTDERSKVFDFSTPYYTAKNKLIVKKSDLATYQSVNDLAQKKVGAQKGSIQETMAKDLLQNSSLVSLPKNGNLITDLKSGQVDAVIFEEPVAKGFVENNPDLAIADLNFEKEQDDSYAVAMKKDSKELKEAVDKTIQKLKESGELDKLIEDAFKASIEK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ARG_A_2(4I62)
?
[Raw transfer]




ARG_A_2(4I62)
?
[Raw transfer]




ARG_A_12(4H5G)
?
[Raw transfer]




1 PsiBlast_PDB 95.05100% -76 - C2 -4I62 5.6 ?
47 HHSearch 89.6299% -24 - C2 -4I62 5.6 ?
2 PsiBlast_PDB 80.2151% -89 - C2 -4H5F - ? -
3 PsiBlast_PDB 79.8751% -86 - C2 -4H5G 3.8 ?
23 PsiBlast_CBE 79.1651% -88 - C2 -4H5F - ? -
21 PsiBlast_CBE 78.4951% -87 - C2 -4H5G - ? -
24 PsiBlast_CBE 78.3051% -81 - C2 -4H5F - ? -
4 PsiBlast_PDB 71.6735% -89 - C2 -4YMX - ? -
25 PsiBlast_CBE 71.1735% -86 - C2 -4YMX - ? -
26 PsiBlast_CBE 69.6837%-107 - C2 -4PSH - ? -
8 PsiBlast_PDB 69.3937%-108 - C2 -4PSH - ? -
48 HHSearch 68.6337% -48 - C2 -4YMX - ? -
57 HHSearch 64.8430% -38 - C2 -2Y7I - ? -
5 PsiBlast_PDB 63.5937% -7 - C2 -4ZV1 - ? -
30 PsiBlast_CBE 63.3132% -13 - C2 -2Q2C - ? -
6 PsiBlast_PDB 63.1737% -6 - C2 -4ZV2 - ? -
10 PsiBlast_PDB 62.5432% -14 - C2 -2Q2C - ? -
32 PsiBlast_CBE 62.4232% -9 - C2 -2Q2A - ? -
11 PsiBlast_PDB 62.1432% -11 - C2 -2PVU - ? -
28 PsiBlast_CBE 61.9932% -14 - C2 -2Q2C - ? -