@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr0186: (2017-12-17 )
MKKKDLVDQLVSEIETGKVRTLGIYGHGASGKSTFAQELYQALDSTTVNLLETDPYITSGRHLVVPKDAPNQKVTASLPVAHELESLQRDILALQAGMDVLTIEEPWKASEVLSGAKPILIVEGMSVGFLPKELFEKTICFYTDEETELKRRLARDTTVRNRDASFILASHQMRREQYLRYYKETESKADILVDQSEDKFDVKRT

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OSA_A_4(3N2E)
AROK_HELPY
[Raw transfer]




36 HHSearch 79.2827% -28 - C2 -3ASZ - URK_THET8 -
5 PsiBlast_PDB 78.8827% -24 - C2 -3W34 - URK_THET8 -
35 HHSearch 78.2627% -29 - C2 -3W34 - URK_THET8 -
3 PsiBlast_PDB 78.0127% -31 - C2 -3ASY - URK_THET8 -
1 PsiBlast_PDB 77.7024% -17 - C2 -5B3F - ? -
4 PsiBlast_PDB 76.7827% -27 - C2 -3ASZ - URK_THET8 -
2 PsiBlast_PDB 76.1727% -34 - C2 -3W8R - URK_THET8 -
8 PsiBlast_PDB 75.5723% 9 - C2 -1UEJ - UCK2_HUMAN -
38 HHSearch 74.6923% 15 - C2 -1UJ2 - UCK2_HUMAN -
6 PsiBlast_PDB 73.5423% 16 - C2 -1UDW - UCK2_HUMAN -
7 PsiBlast_PDB 73.3923% 12 - C2 -1UEI - UCK2_HUMAN -
33 HHSearch 73.2123% 1 - C2 -5B3F - ? -
24 Fugue 73.1419% -6 - C2 -2JEO - UCK1_HUMAN -
11 PsiBlast_PDB 71.0923% 13 - C2 -1XRJ - UCK2_HUMAN -
41 HHSearch 71.0721% 10 - C2 -2JEO - UCK1_HUMAN -
10 PsiBlast_PDB 70.1923% 13 - C2 -1UJ2 - UCK2_HUMAN -
9 PsiBlast_PDB 69.6123% 11 - C2 -1UFQ - UCK2_HUMAN -
40 HHSearch 69.1120% 14 - C2 -2GES - COAA_MYCTU -
25 Fugue 68.4219% -8 - C2 -2UVQ - UCK1_HUMAN -
37 HHSearch 67.7020% 14 * C2 *4BFZ - COAA_MYCTU -