@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr0298: (2017-12-19 )
MLEIGILNSEYVIISISRRCFRLEKKLTIKDIAEMAQTSKTTVSFYLNGKYEKMSQETREKIEKVIHETNYKPSIVARSLNSKRTKLIGVLIGDITNSFSNQIVKGIEDIASQNGYQVMIGNSNYSQESEDRYIESMLLLGVDGFIIQPTSNFRKYSRIIDEKKKKMVFFDSQLYEHRTSWVKTNNYDAVYDMTQSCIEKGYEYFLLITADTSRLSTRIERASGFVDALTDANMRHASLTIEDKHTNLEQIKEFLQKEIDPDEKTLVFIPNCWALPLVFTVIKELNYNLPQVGLIGFDNTEWTCFSSPSVSTLVQPSFEEGQQATKILIDQIEGRNQEERQQVLDCSVNWKESTF

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_E_5(3OQN)
CCPA_BACSU
[Raw transfer]
-
NACID_B_6(3OQM)
CCPA_BACSU
[Raw transfer]
-
2 PsiBlast_PDB 78.0926% -66 - C3 -3OQN 4.3 CCPA_BACSU
1 PsiBlast_PDB 77.0226% -63 - C3 -3OQM 3.5 CCPA_BACSU
3 PsiBlast_PDB 76.6926% -66 - C3 -3OQO - CCPA_BACSU -
6 PsiBlast_PDB 73.1828% -77 - C3 -1RZR - CCPA_BACME -
19 PsiBlast_PDB 73.1228% -41 - C3 -1QP7 - PURR_ECOLI -
13 PsiBlast_PDB 72.7928% -39 - C3 -1QP0 - PURR_ECOLI -
10 PsiBlast_PDB 72.7128% -42 - C3 -1PNR - PURR_ECOLI -
54 HHSearch 72.6726% -59 * C3 *1RZR - CCPA_BACME -
18 PsiBlast_PDB 72.5528% -43 - C3 -1BDH - PURR_ECOLI -
59 HHSearch 72.4026% -21 - C3 -1JFT - PURR_ECOLI -
12 PsiBlast_PDB 72.3828% -44 - C3 -1WET - PURR_ECOLI -
11 PsiBlast_PDB 72.2928% -46 - C3 -1BDI - PURR_ECOLI -
16 PsiBlast_PDB 72.1128% -42 - C3 -1ZAY - PURR_ECOLI -
5 PsiBlast_PDB 71.6928% -81 - C3 -1ZVV - CCPA_BACSU -
8 PsiBlast_PDB 71.5527% -26 - C3 -1JFT - PURR_ECOLI -
15 PsiBlast_PDB 71.4728% -41 - C3 -1QPZ - PURR_ECOLI -
20 PsiBlast_PDB 71.3428% -46 - C3 -1QQA - PURR_ECOLI -
14 PsiBlast_PDB 71.2728% -42 - C3 -1QP4 - PURR_ECOLI -
17 PsiBlast_PDB 71.0827% -25 - C3 -1JFS - PURR_ECOLI -
9 PsiBlast_PDB 70.6627% -25 - C3 -1JH9 - PURR_ECOLI -