@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr0663: (2017-12-27 )
MSVLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEFLGQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAFLKKNREENQANLKKVFSRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDIIQDIQKQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASSEEVRKAYLGG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_2(1JI0)
?
[Raw transfer]




ATP_A_2(1JI0)
?
[Raw transfer]




GOL_A_5(4P33)
LPTB_ECOLI
[Raw transfer]




GOL_B_11(4P33)
LPTB_ECOLI
[Raw transfer]




41 HHSearch 96.8057%-131 - C1 -1JI0 5.3 ?
1 PsiBlast_PDB 95.6456%-132 - C1 -1JI0 5.3 ?
44 HHSearch 70.7633% -18 - C1 -4P32 - LPTB_ECOLI -
6 PsiBlast_PDB 68.2133% -24 - C1 -4P32 - LPTB_ECOLI -
23 PsiBlast_CBE 67.8733% -31 - C1 -4P32 - LPTB_ECOLI -
24 PsiBlast_CBE 67.4832% -24 - C1 -4P33 2.6 LPTB_ECOLI
3 PsiBlast_PDB 66.4133% -20 - C1 -4QC2 - ? -
22 PsiBlast_CBE 66.4033% -20 - C1 -4QC2 - ? -
7 PsiBlast_PDB 65.9032% -26 - C1 -4P33 2.6 LPTB_ECOLI
12 PsiBlast_PDB 62.1030% -35 - C1 -2IT1 - ? -
5 PsiBlast_PDB 60.5633% -5 - C1 -4P31 - LPTB_ECOLI -
2 PsiBlast_PDB 59.4635% -20 - C1 -4WBS - ? -
56 HHSearch 59.3332% -59 * C1 *4YER - ? -
8 PsiBlast_PDB 58.9029% -32 - C1 -1G6H - LIVG_METJA -
4 PsiBlast_PDB 57.4531% -2 - C1 -5X5Y - ? -
15 PsiBlast_PDB 57.0027% -37 - C1 -4U02 - ? -
10 PsiBlast_PDB 56.7329% -39 - C1 -1G9X - LIVG_METJA -
57 HHSearch 56.7132% -46 - C1 -2YYZ - ? -
20 PsiBlast_PDB 56.5230% -7 - C1 -4YMW - ? -
9 PsiBlast_PDB 56.3729% -37 - C1 -1GAJ - LIVG_METJA -