@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr0674: (2017-12-27 )
MAIILPELPYAYDALEPYIDAETMHLHHDKHHQTYVNNANAALEKHPEIGEDLEALLADVESIPADIRQALINNGGGHLNHALFWELMTPEKTAPSAELAAAIDATFGSFEEFQAAFTAAATTRFGSGWAWLVVNKEGKLEVTSTANQDTPISEGKKPILGLDVWEHAYYVKYRNVRPDYIKAFFSVINWNKVDELYAAAK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_B_14(4YIO)
?
[Raw transfer]




21 PsiBlast_CBE 96.4085%-125 - C10 -4YIO 3.3 ?
2 PsiBlast_PDB 96.3883%-128 - C10 -4YIP - SODM_STRMU -
235 HHSearch 94.0085%-115 - C10 -4YIO - ? -
1 PsiBlast_PDB 93.5885%-116 - C10 -4YIO - ? -
84 PsiBlast_CBE 77.7546%-107 - C10 -3H1S - ? -
237 HHSearch 76.0555% -41 - C10 -3TJT - ? -
238 HHSearch 75.8155% -38 - C10 -4JZG - ? -
7 PsiBlast_PDB 75.5455% -45 - C10 -3KKY - SODM_DEIRA -
8 PsiBlast_PDB 75.1655% -43 - C10 -2CDY - SODM_DEIRA -
9 PsiBlast_PDB 75.0355% -42 - C10 -2CE4 - SODM_DEIRA -
10 PsiBlast_PDB 74.5457% -35 - C10 -3TJT - ? -
250 HHSearch 74.4055% -24 - C10 -1IXB - SODM_ECOLI -
13 PsiBlast_PDB 74.2657% -31 - C10 -4JZG - ? -
11 PsiBlast_PDB 74.2557% -31 - C10 -4JYY - ? -
20 PsiBlast_PDB 73.8654% -16 - C10 -1D5N - SODM_ECOLI -
12 PsiBlast_PDB 73.7657% -31 - C10 -4JZ2 - ? -
15 PsiBlast_PDB 73.5955% -26 - C10 -2AW9 - SODM_DEIRA -
14 PsiBlast_PDB 73.0455% -22 - C10 -1Y67 - SODM_DEIRA -
18 PsiBlast_PDB 71.7754% -8 - C10 -1VEW - SODM_ECOLI -
243 HHSearch 71.6146% -72 - C10 -2NYB - SODF_ECOLI -