@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr0839: (2017-12-30 )
MINQKEGDFLRTYENKEELKAEIEKTFEKYILEFDNIPENLKDKRADEVDRTPAENLAYQVGWTNLVLKWEEDERKGLQVKTPSDKFKWNQLGELYQWFTDTYAHLSLQELKAKLNENINSISAMIDSLSEEELFEPHMRKWADEATKTATWEVYKFIHVNTVAPFGTFRTKIRKWKKIVL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TAR_A_3(5COM)
?
[Raw transfer]




MRD_B_4(5CQV)
?
[Raw transfer]




MRD_B_4(5CQV)
?
[Raw transfer]




MPD_A_3(5CQV)
?
[Raw transfer]




23 HHSearch 91.7299% -43 - C6 -4N6C - ? -
1 PsiBlast_PDB 90.8398% -41 - C6 -4N6C - ? -
24 HHSearch 90.8199% -38 - C6 -4N6C - ? -
2 PsiBlast_PDB 88.4787% -52 - C6 -5COM 3.3 ?
44 Fugue 76.2194% 96 - C6 -4N6C - ? -
3 PsiBlast_PDB 73.4171% -18 - C6 -5CQV 2.9 ?
22 PsiBlast_CBE 72.0171% -18 - C6 -5CQV 3.0 ?
26 HHSearch 71.9453% -29 - C6 -5COG - IRC4_YEAST -
27 HHSearch 70.7747% -39 - C6 -5CIV - ? -
5 PsiBlast_PDB 70.6347% -41 - C6 -5CIV - ? -
4 PsiBlast_PDB 63.2952% -18 - C6 -5COG - IRC4_YEAST -
25 HHSearch 61.7932% 53 - C6 -5COF - ? -
6 PsiBlast_PDB 58.8431% 55 - C6 -5COF - ? -
35 HHSearch 53.5714%-115 - C- -2P1A - ? -
36 HHSearch 50.9414%-113 - C- -2P1A - ? -
42 HHSearch 50.469%-100 - C6 -2QE9 - YIZA_BACSU -
43 HHSearch 48.739% -85 - C6 -2QE9 - YIZA_BACSU -
37 HHSearch 46.918% -62 - C6 -3DKA - YJOA_BACSU -
32 HHSearch 46.518% 12 - C6 -3CEX - ? -
33 HHSearch 45.287% -39 - C6 -3GOR - ? -