@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr1107: (2018-01-05 )
MCLLTIFWYNSREKGEHMKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRSQPMPVDGQEADSKPQPIQIGDLEIVPDAYVAKKYGEELDLTHREFELLYHLASHTGQVITREHLLETVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYILTRRGVGYYMRNNA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_B_23(5DCL)
?
[Raw transfer]




EDO_B_24(5DCL)
?
[Raw transfer]




PG4_A_4(3A0U)
?
[Raw transfer]




GOL_B_10(4QPJ)
CTRA_BRUA2
[Raw transfer]




225 HHSearch 85.9443%-125 - C2 -2GWR - MTRA_MYCTU -
228 HHSearch 81.7842% -50 - C4 -1YS6 - PRRA_MYCTU -
4 PsiBlast_PDB 81.65100%-127 - C2 -1NXV - ? -
5 PsiBlast_PDB 81.11100%-125 - C2 -1NXW - ? -
7 PsiBlast_PDB 80.25100%-120 - C2 -2A9O - ? -
6 PsiBlast_PDB 80.09100%-143 - C2 -1NXX - ? -
8 PsiBlast_PDB 80.04100%-122 - C2 -2A9P - ? -
229 HHSearch 79.6242% -51 - C4 -1YS7 - PRRA_MYCTU -
3 PsiBlast_PDB 79.48100%-131 - C2 -1NXS - ? -
2 PsiBlast_PDB 78.82100%-121 - C2 -1NXP - ? -
11 PsiBlast_PDB 76.5244% -49 - C4 -1YS6 - PRRA_MYCTU -
226 HHSearch 76.3944% -91 - C4 -2OQR - REGX3_MYCTU -
25 PsiBlast_CBE 75.2637% -42 - C4 -5ED4 - ? -
9 PsiBlast_PDB 74.83100%-140 - C- -2A9Q - ? -
20 PsiBlast_PDB 74.7536% -81 - C2 -4KNY - KDPE_ECOLI -
21 PsiBlast_CBE 74.1244% -44 - C4 -1YS7 - PRRA_MYCTU -
17 PsiBlast_PDB 73.6237% -42 - C4 -5ED4 - ? -
12 PsiBlast_PDB 73.4444% -53 - C4 -1YS7 - PRRA_MYCTU -
22 PsiBlast_CBE 73.3944% -43 - C4 -1YS6 - PRRA_MYCTU -
234 HHSearch 73.2638% -73 - C2 -1P2F - ? -