@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr1145: (2018-01-06 )
MKAIILAAGLGTRLRPMTENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIVGYLKEQFDYLKEKYGVRLVFNDKYADYNNFYSLYLVKEELANSYVIDADNYLFKNMFRNDLTRSTYFSVYREDCTNEWFLVYGDDYKVQDIIVDSKAGRILSGVSFWDAPTAEKIVSFIDKAYASGEFVDLYWDNMVKDNIKELDVYVEELEGNSIYEIDSVQDYRKLEEILKNEN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CDC_D_12(1JYL)
?
[Raw transfer]




CDC_C_11(1JYL)
?
[Raw transfer]




CDC_B_10(1JYL)
?
[Raw transfer]




CDC_A_9(1JYL)
?
[Raw transfer]




2 PsiBlast_PDB 87.7097%-159 - C2 -1JYK - ? -
21 PsiBlast_CBE 86.2598%-157 - C2 -1JYL 6.6 ?
22 PsiBlast_CBE 86.1298%-157 - C2 -1JYL 6.8 ?
1 PsiBlast_PDB 85.1898%-158 - C2 -1JYL 6.8 ?
23 PsiBlast_CBE 84.6698%-159 - C2 -1JYL 6.3 ?
135 Fugue 80.0798% -6 - C2 -1JYK - ? -
113 HHSearch 80.0797%-103 - C2 -1JYK - ? -
136 Fugue 41.4820% -1 - C2 -1FXO - ? -
100 PsiBlast_CBE 41.2549%-192 - C1 -5FU0 - ? -
89 PsiBlast_CBE 41.1849%-209 - C1 -5FYE - ? -
107 PsiBlast_CBE 41.1149%-218 - C1 -5FTS - ? -
88 PsiBlast_CBE 40.9949%-211 - C1 -5FYE - ? -
62 PsiBlast_CBE 40.9449%-190 - C1 -1H5S - RMLA1_ECOLI -
68 PsiBlast_CBE 40.5849%-197 - C1 -1H5R - RMLA1_ECOLI -
109 PsiBlast_CBE 40.5149%-207 - C1 -5FTS - ? -
92 PsiBlast_CBE 39.9949%-204 - C1 -5FUH - ? -
105 PsiBlast_CBE 39.9049%-215 - C1 -5FTV - ? -
4 PsiBlast_PDB 39.8962%-190 - C1 -2GGQ - ? -
93 PsiBlast_CBE 39.7649%-193 - C1 -5FUH - ? -
87 PsiBlast_CBE 39.1349%-208 - C1 -5FYE - ? -