@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr1408: (2018-01-11 )
MEKKIVKDILFLSQVSQPASQEDLYLARDLQDTLLANRDTCVGLAANMIGVQKRVIIFNLGLVPVVMFNPVLLSFEGSYEAEEGCLSLVGVRSTKRYETIRLAYRDSKWQEQTITLTGFPAQICQHELDHLEGRII

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

56F_A_9(5CVP)
?
[Raw transfer]




BRR_B_7(1RL4)
?
[Raw transfer]




FMT_A_3(1XEO)
DEF_ECOLI
[Raw transfer]




50 PsiBlast_CBE 86.3032% -93 - C5 -5KOB - ? -
86 PsiBlast_CBE 85.5832% -40 - C5 -5HGW - ? -
85 PsiBlast_CBE 85.0732% -38 - C5 -5HGW - ? -
52 PsiBlast_CBE 84.7532% -96 - C5 -5KOB - ? -
84 PsiBlast_CBE 84.4132% -14 - C5 -5I2B - ? -
116 HHSearch 83.6933% -43 - C5 -1Y6H - DEF_LEPIN -
48 PsiBlast_CBE 83.5332% -88 - C5 -5VCP - ? -
45 PsiBlast_CBE 82.6332%-113 - C5 -5VCP - ? -
51 PsiBlast_CBE 82.5032% -85 - C5 -5KOB - ? -
49 PsiBlast_CBE 82.0232%-112 - C5 -5KOB - ? -
47 PsiBlast_CBE 81.9932% -85 - C5 -5VCP - ? -
46 PsiBlast_CBE 81.5532% -87 - C5 -5VCP - ? -
3 PsiBlast_PDB 80.2231% -46 - C5 -1LME - DEF_THEMA -
53 PsiBlast_CBE 79.1031% -19 - C5 -1LQY - DEF2_GEOSE -
117 HHSearch 78.5934% 3 - C5 -1V3Y - DEF_THETH -
105 HHSearch 77.7232% -19 - C5 -3U04 - ? -
99 HHSearch 77.4730% -16 - C5 -4WXK - DEF_HAEI8 -
5 PsiBlast_PDB 77.3932% -55 - C5 -3QU1 - DEF2_VIBCH -
100 HHSearch 76.9428% 15 * C5 *1XEO 3.4 DEF_ECOLI
102 HHSearch 76.3528% -27 - C5 -1WS0 - DEF1_BACCR -