@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr1669: (2018-01-17 )
MATLKDIAQLASVSIATVSRVLNRDQSLSVTEETRHRILTVAEELGYTKHLKTGESHKPKQKIAIIQWVSEQGELDDLYYYQIRLGIEKRAQELDYDILRYFNDHPFTLSEEVIGILCIGKFSRAQISAFEEYQKPLVFLDSDTLSLGHTCIITDFYTAMKQVVDYFLSQGMDRIGILTGLEETTDQEEIIQDKRLENFKNYSQARGIYHDELVFQGRFTAQSGYDLMKEAIQSLGDQLPPAFFAASDSLAIGALRALQEAGISLPDRVSLISFNDTSLTKQVYPPLSSITVYTEEMGRAGMDILNKEVLHGRKIPSLTMLGTRLTLRESTLNQE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_B_1(1JH9)
PURR_ECOLI
[Raw transfer]
-
NACID_M_1(1QPZ)
PURR_ECOLI
[Raw transfer]
-
17 PsiBlast_PDB 71.7625% -7 - C1 -1QPZ 4.4 PURR_ECOLI
12 PsiBlast_PDB 71.3925% -6 - C1 -1PNR - PURR_ECOLI -
51 HHSearch 70.9225% -24 - C1 -1JFT - PURR_ECOLI -
16 PsiBlast_PDB 70.9225% -4 - C1 -1QP4 - PURR_ECOLI -
14 PsiBlast_PDB 70.8425% -5 - C1 -1WET - PURR_ECOLI -
7 PsiBlast_PDB 70.6625% -3 - C1 -1JFT - PURR_ECOLI -
11 PsiBlast_PDB 70.4025% -1 - C1 -1JH9 5.5 PURR_ECOLI
15 PsiBlast_PDB 70.1525% -4 - C1 -1QP0 - PURR_ECOLI -
10 PsiBlast_PDB 70.0825% -5 - C1 -2PUG - PURR_ECOLI -
20 PsiBlast_PDB 69.9425% -10 - C1 -2PUB - PURR_ECOLI -
9 PsiBlast_PDB 69.9225% -3 - C1 -2PUF - PURR_ECOLI -
3 PsiBlast_PDB 69.8627% -12 - C1 -3OQN - CCPA_BACSU -
8 PsiBlast_PDB 69.4525% -5 - C1 -2PUE - PURR_ECOLI -
19 PsiBlast_PDB 69.2325% -6 - C1 -2PUA - PURR_ECOLI -
2 PsiBlast_PDB 69.2327% -7 - C1 -3OQM - CCPA_BACSU -
46 HHSearch 68.7726% 1 - C1 -1RZR - CCPA_BACME -
18 PsiBlast_PDB 68.6525% -2 - C1 -1ZAY - PURR_ECOLI -
13 PsiBlast_PDB 68.5725% -3 - C1 -1BDI - PURR_ECOLI -
1 PsiBlast_PDB 68.4627% -9 * C1 *3OQO - CCPA_BACSU -
43 HHSearch 67.2024% -35 - C1 -2PE5 - LACI_ECOLI -