@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr1712: (2018-01-18 )
MEWYKKIGLLATTGLALFGLGACSNYGKSADGTVTIEYFNQKKEMTKTLEEITRDFEKENPKIKVKVVNVPNAGEVLKTRVLAGDVPDVVNIYPQSIELQEWAKAGVFEDLSNKDYLKRVKNGYAEKYAVNEKVYNVPFTANAYGIYYNKDKFEELGLKVPETWDEFEQLVKDIVAKGQTPFGIAGADAWTLNGYNQLAFATATGGGKEANQYLRYSQPNAIKLSDPIMKDDIKVMDILRINGSKQKNWEGAGYTDVIGAFARGDVLMTPNGSWAITAINEQKPNFKIGTFMIPGKEKGQSLTVGAGDLAWSISATTKHPKEANAFVEYMTRPEVMQKYYDVDGSPTAIEGVKQAGEDSPLAGMTEYAFTDRHLVWLQQYWTSEADFHTLTMNYVLTGDKEGMVNDLNAFFNPMKADVD

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SUGAR_C_3(2I58)
?
[Raw transfer]

-

SUGAR_D_4(2I58)
?
[Raw transfer]

-

2 PsiBlast_PDB 99.4099% -75 - C1 -2HQ0 - ? -
23 PsiBlast_CBE 99.2599% -75 - C1 -2I58 6.4 ?
3 PsiBlast_PDB 97.5799% -68 - C1 -2I58 6.5 ?
1 PsiBlast_PDB 97.2999% -75 - C1 -2HEU - ? -
21 PsiBlast_CBE 97.1699% -73 - C1 -2HEU - ? -
27 HHSearch 96.6496% -69 - C1 -2HQ0 - ? -
4 PsiBlast_PDB 95.5096% -72 - C1 -2HFB - ? -
28 HHSearch 94.9996% -68 - C1 -2HEU - ? -
51 Fugue 45.9222% 5 - C1 -5T0A - H6ST3_DANRE (first) -
25 HHSearch 42.4020% 34 * C1 *3VXC - ? -
46 Fugue 41.8817% 35 - C1 -2B3F - ? -
37 HHSearch 41.4419% 43 - C1 -4G68 - ? -
24 HHSearch 40.9320% 38 - C1 -3VXB - ? -
26 HHSearch 40.0719% 44 - C1 -4G68 - ? -
5 PsiBlast_PDB 39.8226% 19 - C1 -4ZZE - ? -
6 PsiBlast_PDB 39.8026% 17 - C1 -4ZS9 - ? -
35 HHSearch 39.2121% - - C1 -3UOR - ? -
36 HHSearch 39.0721% - - C1 -3UOR - ? -
50 Fugue 38.2414% 21 - C1 -3I3V - ? -
7 PsiBlast_PDB 38.1326% 18 - C1 -4ZZA - ? -