@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr1768: (2018-01-19 )
MNKIFIYAGVRNHNSKTLEYTKRLSSIISSRNNVDISFRTPFNSELEISNSDSEELFKKGIDRQSNADDGGVIKKELLESDIIIISSPVYLQNVSVDTKNFIERIGGWSHLFRLAGKFVVTLDVAESNGSDNVSEYLRDIFSYMGGQILHQVSITNSLKDIAEAQLMEATYKIEDVLEGKIKYKTTDYQERAYQTLKLILENYDSEHFEKMYWEKKRLFEANSLEEWYYVENIK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_A_3(2OYS)
?
[Raw transfer]




2 PsiBlast_PDB 89.2898% -84 - C1 -2OYS 9.3 ?
1 PsiBlast_PDB 88.1798% -81 - C1 -1SQS - ? -
20 PsiBlast_CBE 87.3698% -80 - C1 -1SQS - ? -
31 HHSearch 77.2992% 3 - C1 -1SQS - ? -
30 Fugue 43.1515% 6 * C1 *1TIK - AZOR_ECOLI -
3 PsiBlast_PDB 42.3226%-195 - C1 -4ESE - AZOR_YERPE -
44 HHSearch 38.2314% 5 - C1 -2D5I - AZOR_ECOLI -
42 HHSearch 38.2015% -82 - C1 -3U7R - ? -
27 Fugue 37.7511% -54 - C1 -1ZWK - NQOR_PSEAE -
45 HHSearch 37.7013% -36 - C1 -4GI5 - ? -
9 PsiBlast_PDB 37.4424%-102 - C1 -2Z9B - AZOR_ECOLI -
46 HHSearch 37.2313% -35 - C1 -4GI5 - ? -
33 HHSearch 37.0014% -22 - C1 -3U7I - AZOR1_BACAN -
5 PsiBlast_PDB 36.9125%-104 - C1 -1T5B - AZOR_SALTY -
43 HHSearch 36.8814% 11 - C1 -2Z98 - AZOR_ECOLI -
25 Fugue 36.3717% -58 - C1 -3FVW - ? -
49 HHSearch 36.3616% -13 - C1 -4C0X - AZOR1_PSEPK -
36 HHSearch 36.2013% -30 - C1 -4R81 - ? -
11 PsiBlast_PDB 35.5524% -98 - C1 -2Z9D - AZOR_ECOLI -
39 HHSearch 35.5416% -36 - C1 -1YDG - NQOR_DEIRA -