@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr1825: (2018-01-20 )
MICSDSSYSFHNKNFMIFIRRKSLMVVKVGINGFGRIGRLAFRRIQNVEGVEVTRINDLTDPVMLAHLLKYDTTQGRFDGTVEVKEGGFEVNGKFIKVSAERDPEQIDWATDGVEIVLEATGFFAKKEAAEKHLKGGAKKVVITAPGGNDVKTVVFNTNHDVLDGTETVISGASCTTNCLAPMAKALQDNFGVVEGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVIPELNGKLDGSAQRVPTPTGSVTELVAVLEKNVTVDEVNAAMKAASNESYGYTEDPIVSSDIVGMSYGSLFDATQTKVLDVDGKQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_R_(3CMC)
G3P_GEOSE
[Raw transfer]




1 PsiBlast_PDB 88.6399% -70 - C6 -5M6D - ? -
24 PsiBlast_CBE 88.5890% -78 - C6 -5JY6 - ? -
21 PsiBlast_CBE 88.0899% -72 - C6 -5M6D - ? -
123 HHSearch 87.6298% -67 - C6 -5M6D - ? -
35 PsiBlast_CBE 83.0072% -80 - C6 -5VMT - ? -
4 PsiBlast_PDB 82.8172% -80 - C6 -5VMT - ? -
2 PsiBlast_PDB 82.7790% -26 - C6 -5JY6 - ? -
32 PsiBlast_CBE 82.6872% -85 - C6 -5VMT - ? -
28 PsiBlast_CBE 82.3490% -23 - C6 -4QX6 - ? -
23 PsiBlast_CBE 82.1590% -25 - C6 -5JY6 - ? -
27 PsiBlast_CBE 81.7890% -24 - C6 -4QX6 - ? -
22 PsiBlast_CBE 81.6990% -26 - C6 -5JYE - ? -
25 PsiBlast_CBE 81.6390% -23 - C6 -5JY6 - ? -
26 PsiBlast_CBE 81.5990% -23 - C6 -4QX6 - ? -
34 PsiBlast_CBE 81.1272% -80 - C6 -5VMT - ? -
37 PsiBlast_CBE 80.6572% -77 - C6 -5VMT - ? -
31 PsiBlast_CBE 80.4890% -27 - C6 -5JYA - ? -
3 PsiBlast_PDB 80.3890% -25 - C6 -5JYE - ? -
40 PsiBlast_CBE 80.3169% -58 - C6 -3LC2 - G3P1_STAAR -
6 PsiBlast_PDB 80.2869% -57 - C6 -3L6O - G3P1_STAAR -
83 PsiBlast_CBE 72.9056% -35 - C6 -3CMC 8.0 G3P_GEOSE