@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr1895: (2018-01-22 )
MKFKKMLTLAAIGLSGFGLVACGNQSAASKQSASGTIEVISRENGSGTRGAFTEITGILKKDGDKKIDNTAKTAVIQNSTEGVLSAVQGNANAIGYISLGSLTKSVKALEIDGVKASRDTVLDGEYPLQRPFNIVWSSNLSKLGQDFISFIHSKQGQQVVTDNKFIEAKTETTEYTSQHLSGKLSVVGSTSVSSLMEKLAEAYKKENPEVTIDITSNGSSAGITAVKEKTADIGMVSRELTPEEGKSLTHDAIALDGIAVVVNNDNKASQVSMAELADVFSGKLTTWDKIK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CIT_A_3(4H1X)
PSTS2_STRPN
[Raw transfer]




CIT_A_3(4H1X)
PSTS2_STRPN
[Raw transfer]




CIT_A_3(4H1X)
PSTS2_STRPN
[Raw transfer]




1 PsiBlast_PDB 95.8698% -99 - C4 -4H1X 4.2 PSTS2_STRPN
27 HHSearch 89.0399% -27 - C4 -4H1X 4.2 PSTS2_STRPN
47 Fugue 86.0898% -14 - C4 -4H1X 4.2 PSTS2_STRPN
6 PsiBlast_PDB 48.8335% -49 - C4 -4OMB - PSTS_PSEAE -
5 PsiBlast_PDB 47.1135% -44 - C4 -4PQJ - PSTS_PSEAE -
2 PsiBlast_PDB 47.0841% -59 - C4 -4Q8R - ? -
4 PsiBlast_PDB 47.0433% -63 - C4 -1TWY - ? -
21 PsiBlast_CBE 46.5641% -53 - C4 -4GD5 - ? -
19 PsiBlast_PDB 46.5625% -74 - C4 -1A55 - PSTS_ECOLI -
3 PsiBlast_PDB 46.5241% -44 - C4 -4GD5 - ? -
18 PsiBlast_PDB 45.4825% -61 - C4 -1A54 - PSTS_ECOLI -
20 PsiBlast_PDB 45.3025% -62 - C4 -1QUI - PSTS_ECOLI -
46 HHSearch 45.2636% -75 - C4 -1TWY - ? -
7 PsiBlast_PDB 45.1522% -86 - C4 -4JWO - ? -
12 PsiBlast_PDB 44.7126% -33 - C4 -4LVQ - PSTS3_MYCTU -
17 PsiBlast_PDB 44.6725% -63 - C4 -1IXI - PSTS_ECOLI -
34 HHSearch 43.9826% -56 - C4 -2Z22 - ? -
35 HHSearch 43.2525% -50 * C4 *1IXH - PSTS_ECOLI -
48 Fugue 42.7529%-131 - C4 -5KP7 - ? -
39 HHSearch 42.3526% -59 - C4 -4N13 - PSTS_BORBU -