@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VKB1: (2017-10-25 )
MTSGFETLNLHPQLKKAIDALGFTQMTPIQQKVLKYTLAGHDAIGRAQTGTGKTAAFLISVINDLLNNPVQEQRFRGEPRALILAPTRELALQIESDAKSLTKFSNLHLVTLLGGVDFDKQKKQLDANFVDIMVATPGRLIDFVEQKEVWLDQIEFLVIDEADRLLDMGFIPSVKRIVRYSPRKEQRQTLMFSATFSYDVLNLARQWLFEPVTVEIEPEQKTNNDVEQRVYVVAKQDKYRLLQDILREEPIDKVMIFANRRDQVRRLYDHLKKDGYKVGMLSGEIAQDKRLKMLEQFKQGKHNIMIATDVAGRGIHVEGVSHVVNFTLPEQSDDYVHRIGRTGRAGAQGVSISFLSEDDAFYLPEIEKAIGKKLPLTRLDGYC

Atome Classification :

(26 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

8OD_A_6(3NBF)
?
[Raw transfer]




8OD_C_11(3NBF)
?
[Raw transfer]




8OD_D_13(3NBF)
?
[Raw transfer]




8OD_B_8(3NBF)
?
[Raw transfer]




GOL_D_5(4D25)
?
[Raw transfer]




GOL_D_5(4D25)
?
[Raw transfer]




GOL_B_10(3FHT)
DD19B_HUMAN
[Raw transfer]




NACID_H_4(2DB3)
VASA1_DROME
[Raw transfer]

-

TLA_B_4(1VEC)
DDX6_HUMAN
[Raw transfer]




NACID_F_2(2DB3)
VASA1_DROME
[Raw transfer]

-

NACID_G_7(4DB2)
MS116_YEAST
[Raw transfer]

-

24 PsiBlast_CBE 88.8335%-114 - C2 -2DB3 11.2 VASA1_DROME
22 PsiBlast_CBE 88.4835%-112 - C2 -2DB3 12.4 VASA1_DROME
23 PsiBlast_CBE 88.2635%-112 - C2 -2DB3 - VASA1_DROME -
9 PsiBlast_PDB 88.0035%-113 - C2 -2DB3 - VASA1_DROME -
119 HHSearch 86.9236%-114 - C2 -2DB3 - VASA1_DROME -
113 HHSearch 82.3937%-111 - C2 -5IVL - ? -
123 HHSearch 82.2232%-135 - C2 -1S2M - DHH1_YEAST -
117 HHSearch 82.0738% -13 - C2 -4D25 2.1 ?
116 HHSearch 81.5638% -15 - C2 -4D26 - ? -
2 PsiBlast_PDB 80.2237% -14 - C2 -4D25 2.1 ?
12 PsiBlast_PDB 79.9632% -88 - C2 -3EX7 - IF4A3_HUMAN -
15 PsiBlast_PDB 79.9132% -86 - C2 -2J0S - IF4A3_HUMAN -
3 PsiBlast_PDB 79.8637% -16 - C2 -4D26 - ? -
27 PsiBlast_CBE 79.4332% -83 - C2 -2XB2 - IF4A3_HUMAN -
14 PsiBlast_PDB 79.3732% -81 - C2 -2J0Q - IF4A3_HUMAN -
28 PsiBlast_CBE 79.3632% -81 - C2 -2J0Q - IF4A3_HUMAN -
13 PsiBlast_PDB 79.2532% -82 - C2 -2XB2 - IF4A3_HUMAN -
11 PsiBlast_PDB 79.1832% -87 - C2 -2HYI - IF4A3_HUMAN -
25 PsiBlast_CBE 79.0132% -82 - C2 -3EX7 - IF4A3_HUMAN -
26 PsiBlast_CBE 78.5132% -83 - C2 -2HYI - IF4A3_HUMAN -
73 PsiBlast_CBE 57.6340% -49 - C2 -3NBF 5.1 ?
72 PsiBlast_CBE 57.3340% -52 - C2 -3NBF 5.9 ?
71 PsiBlast_CBE 57.1340% -53 - C2 -3NBF 5.5 ?
70 PsiBlast_CBE 55.4740% -57 - C2 -3NBF 5.6 ?
95 PsiBlast_CBE 51.1331% -43 - C2 -1VEC 2.0 DDX6_HUMAN
106 PsiBlast_CBE 38.3334%-133 - C2 -4DB2 3.4 MS116_YEAST