@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VKB8: (2017-10-25 )
MLYSLARPMLFSLAPERAHELTLSMLDKAHKLGIMRQTVEAKPTTCMGIEFPNPVGLAAGLDKNGAHIDALAGLGFGFIEIGTITPHPQSGNPKPRLFRIPEAKAIINRMGFNNDGVDKLIENVKASKFRGILGINIGKNADTPVEKAVDDYLICLEKVYNYASYITVNISSPNTKNLRSLQSGDALTELLQALKARQLELAEQYNHYVPLVLKVAPDLTAEDVEFISAQLLDFKIDGLIVTNTTLSREGVENLPYGNESGGLSGAPVFEKSTECLRLFAQTLKGQISLIGVGGILSGEQAAAKQQAGATLVQIYSGLIYTGPTLVKQCVEAMT

Atome Classification :

(82 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_H_8(2FPY)
PYRD_HUMAN
[Raw transfer]




78Z_A_2(5TBO)
PYRD_PLAF7
[Raw transfer]




D65_A_2(4RX0)
PYRD_PLAF7
[Raw transfer]




FMN_A_2(4JTS)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(5MUT)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(1UUO)
PYRD_RAT
[Raw transfer]




FMN_A_8(2FPV)
PYRD_HUMAN
[Raw transfer]




FMN_A_7(2FPT)
PYRD_HUMAN
[Raw transfer]




D67_A_2(3SFK)
PYRD_PLAF7
[Raw transfer]




FMN_A_2(4RLI)
PYRD_HUMAN
[Raw transfer]




BRF_A_2(1UUO)
PYRD_RAT
[Raw transfer]




5Y5_A_2(5FI8)
PYRD_PLAF7
[Raw transfer]




FMN_A_2(2WV8)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(2WV8)
PYRD_HUMAN
[Raw transfer]




FMN_A_10(3W7R)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3I68)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(3I6R)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(3O8A)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(3I65)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(4CQ8)
PYRD_PLAF7
[Raw transfer]




FMN_B_6(4CQA)
PYRD_PLAF7
[Raw transfer]




FMN_A_2(4OQV)
PYRD_HUMAN
[Raw transfer]




FMN_A_4(1TV5)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(5TBO)
PYRD_PLAF7
[Raw transfer]




FMN_A_2(4RR4)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4IGH)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(2PRM)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(4CQA)
PYRD_PLAF7
[Raw transfer]




AFI_A_5(1UUM)
PYRD_RAT
[Raw transfer]




FMN_A_3(4RX0)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(5FI8)
PYRD_PLAF7
[Raw transfer]




FMN_B_6(4CQ9)
PYRD_PLAF7
[Raw transfer]




FMN_B_6(4CQ8)
PYRD_PLAF7
[Raw transfer]




FMN_A_2(5DEL)
PYRD_PLAF7
[Raw transfer]




FMN_B_6(4CQ8)
PYRD_PLAF7
[Raw transfer]




FMN_A_2(4OQV)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(4ORM)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(4CQ9)
PYRD_PLAF7
[Raw transfer]




AFI_B_9(1UUM)
PYRD_RAT
[Raw transfer]




FMN_A_3(4XQ6)
PYRD_MYCTU
[Raw transfer]




FMN_A_4(2BXV)
PYRD_HUMAN
[Raw transfer]




FMN_A_5(2PRL)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3SFK)
PYRD_PLAF7
[Raw transfer]




FMN_B_7(4XQ6)
PYRD_MYCTU
[Raw transfer]




FMN_A_2(4ZMG)
PYRD_HUMAN
[Raw transfer]




FMN_C_3(2B0M)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3G0U)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(3U2O)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3KVM)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4LS2)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(2PRH)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(4XQ6)
PYRD_MYCTU
[Raw transfer]




FNR_A_2(5K9D)
PYRD_HUMAN
[Raw transfer]




FMN_B_7(4XQ6)
PYRD_MYCTU
[Raw transfer]




FMN_A_2(4JTT)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4JTU)
PYRD_HUMAN
[Raw transfer]




FMN_A_5(1D3H)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(3F1Q)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(5H2Z)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4RKA)
PYRD_HUMAN
[Raw transfer]




FMN_A_7(2FQI)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3FJ6)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3KVK)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(3ZWS)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(5HQE)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(3FJL)
PYRD_HUMAN
[Raw transfer]




FMN_A_5(1D3G)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(3G0X)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(5HIN)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4JGD)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4JS3)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4RK8)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3KVJ)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4LS1)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(4ZL1)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(3ZWT)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4LS0)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(4YLW)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3KVL)
PYRD_HUMAN
[Raw transfer]




FMN_A_5(1D3G)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4ORI)
PYRD_RAT
[Raw transfer]




FMN_B_7(1UUM)
PYRD_RAT
[Raw transfer]




FMN_A_3(1UUM)
PYRD_RAT
[Raw transfer]




FMN_A_2(5MVC)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(5MVD)
PYRD_HUMAN
[Raw transfer]




GOL_A_16(3W88)
PYRD_TRYCC
[Raw transfer]




2V6_A_2(4ORM)
PYRD_PLAF7
[Raw transfer]




2V6_A_4(4ORI)
PYRD_RAT
[Raw transfer]




A26_A_3(1TV5)
PYRD_PLAF7
[Raw transfer]




D59_A_4(5DEL)
PYRD_PLAF7
[Raw transfer]




OXC_A_5(2E6F)
PYRD_TRYCC
[Raw transfer]




DOR_A_4(3KVM)
PYRD_HUMAN
[Raw transfer]




DDQ_A_6(3W7R)
PYRD_HUMAN
[Raw transfer]




DET_A_4(4JGD)
PYRD_HUMAN
[Raw transfer]




DET_A_5(3KVK)
PYRD_HUMAN
[Raw transfer]




87 HHSearch 84.4255% 10 - C5 -1F76 - PYRD_ECOLI -
1 PsiBlast_PDB 84.1754% 14 - C5 -1F76 - PYRD_ECOLI -
90 HHSearch 79.5939% -75 - C5 -4XQ6 9.7 PYRD_MYCTU
91 HHSearch 79.5839% -75 * C5 *4XQ6 10.5 PYRD_MYCTU
55 PsiBlast_CBE 77.4939% -67 - C5 -4XQ6 10.5 PYRD_MYCTU
56 PsiBlast_CBE 77.2839% -68 - C5 -4XQ6 9.7 PYRD_MYCTU
86 HHSearch 68.4638% 33 - C5 -4CQ8 10.2 PYRD_PLAF7
89 HHSearch 67.3741% 33 - C5 -4OQV 11.0 PYRD_HUMAN
88 HHSearch 66.0841% 39 - C5 -2WV8 9.5 PYRD_HUMAN
59 PsiBlast_CBE 65.9240% 17 - C5 -5DEL 9.4 PYRD_PLAF7
60 PsiBlast_CBE 65.6240% 4 - C5 -4RX0 9.1 PYRD_PLAF7
77 Fugue 65.2938% 19 - C5 -1D3G 10.8 PYRD_HUMAN
18 PsiBlast_PDB 65.2241% 34 - C5 -3G0X 10.0 PYRD_HUMAN
69 PsiBlast_CBE 64.9440% 20 - C5 -5BOO - PYRD_PLAF7 -
4 PsiBlast_PDB 64.8842% 42 - C5 -1UUO 8.9 PYRD_RAT
70 PsiBlast_CBE 64.7640% 18 - C5 -5BOO - PYRD_PLAF7 -
61 PsiBlast_CBE 64.6440% 19 - C5 -4ORM 10.0 PYRD_PLAF7
53 PsiBlast_CBE 64.5541% 35 - C5 -2FPT 9.9 PYRD_HUMAN
46 PsiBlast_CBE 64.4941% 34 - C5 -3KVJ 10.8 PYRD_HUMAN
65 PsiBlast_CBE 64.4740% 22 - C5 -4CQ9 9.9 PYRD_PLAF7
21 PsiBlast_CBE 64.4042% 38 - C5 -1UUM 9.3 PYRD_RAT
31 PsiBlast_CBE 64.3941% 36 - C5 -4RLI 9.4 PYRD_HUMAN
5 PsiBlast_PDB 64.3741% 37 - C5 -3U2O 10.4 PYRD_HUMAN
71 PsiBlast_CBE 64.3240% 22 - C5 -3O8A 9.0 PYRD_PLAF7
30 PsiBlast_CBE 64.3141% 36 - C5 -4RR4 10.0 PYRD_HUMAN
58 PsiBlast_CBE 64.2940% 7 - C5 -5FI8 8.5 PYRD_PLAF7
57 PsiBlast_CBE 64.2740% 0 - C5 -5TBO 9.2 PYRD_PLAF7
36 PsiBlast_CBE 64.2341% 36 - C5 -4LS0 10.0 PYRD_HUMAN
66 PsiBlast_CBE 64.2140% 30 - C5 -4CQ8 10.2 PYRD_PLAF7
44 PsiBlast_CBE 64.1741% 36 - C5 -3KVL 10.6 PYRD_HUMAN
17 PsiBlast_PDB 64.1141% 37 - C5 -3G0U 10.4 PYRD_HUMAN
43 PsiBlast_CBE 64.1041% 33 - C5 -3KVM 10.8 PYRD_HUMAN
12 PsiBlast_PDB 64.0641% 37 - C5 -2PRL 11.0 PYRD_HUMAN
2 PsiBlast_PDB 64.0642% 44 - C5 -4ORI 9.7 PYRD_RAT
6 PsiBlast_PDB 64.0241% 36 - C5 -2WV8 9.5 PYRD_HUMAN
52 PsiBlast_CBE 64.0141% 34 - C5 -2FPV 10.0 PYRD_HUMAN
41 PsiBlast_CBE 64.0141% 36 - C5 -4JGD 10.6 PYRD_HUMAN
64 PsiBlast_CBE 63.9240% 24 - C5 -4CQ9 10.1 PYRD_PLAF7
34 PsiBlast_CBE 63.8841% 34 - C5 -4LS2 10.6 PYRD_HUMAN
47 PsiBlast_CBE 63.8741% 38 - C5 -2B0M 9.4 PYRD_HUMAN
40 PsiBlast_CBE 63.8441% 34 - C5 -4JS3 10.9 PYRD_HUMAN
9 PsiBlast_PDB 63.8341% 37 - C5 -1D3H 9.9 PYRD_HUMAN
10 PsiBlast_PDB 63.7941% 34 - C5 -2BXV 10.1 PYRD_HUMAN
3 PsiBlast_PDB 63.7842% 39 - C5 -1UUM 9.5 PYRD_RAT
48 PsiBlast_CBE 63.7741% 34 - C5 -5K9D 10.8 PYRD_HUMAN
28 PsiBlast_CBE 63.7741% 36 - C5 -4ZL1 10.6 PYRD_HUMAN
19 PsiBlast_PDB 63.7741% 39 - C5 -3ZWS 10.6 PYRD_HUMAN
50 PsiBlast_CBE 63.7541% 38 - C5 -2FQI 10.0 PYRD_HUMAN
39 PsiBlast_CBE 63.6741% 36 - C5 -4JTS 10.6 PYRD_HUMAN
24 PsiBlast_CBE 63.6441% 37 - C5 -5HQE 10.5 PYRD_HUMAN
15 PsiBlast_PDB 63.6441% 37 - C5 -3FJ6 10.5 PYRD_HUMAN
14 PsiBlast_PDB 63.6341% 38 - C5 -3F1Q 10.8 PYRD_HUMAN
74 PsiBlast_CBE 63.5640% 11 - C5 -3I65 10.0 PYRD_PLAF7
67 PsiBlast_CBE 63.5540% 27 - C5 -4CQ8 10.2 PYRD_PLAF7
32 PsiBlast_CBE 63.4241% 34 - C5 -4RKA 9.6 PYRD_HUMAN
38 PsiBlast_CBE 63.4141% 36 - C5 -4JTT 10.5 PYRD_HUMAN
37 PsiBlast_CBE 63.4041% 36 - C5 -4JTU 10.9 PYRD_HUMAN
16 PsiBlast_PDB 63.4041% 37 - C5 -3FJL 10.7 PYRD_HUMAN
51 PsiBlast_CBE 63.3941% 36 - C5 -2FPY 10.1 PYRD_HUMAN
13 PsiBlast_PDB 63.3841% 39 - C5 -2PRM 9.6 PYRD_HUMAN
45 PsiBlast_CBE 63.3741% 34 - C5 -3KVK 10.1 PYRD_HUMAN
20 PsiBlast_PDB 63.3241% 37 - C5 -3ZWT 10.7 PYRD_HUMAN
73 PsiBlast_CBE 63.2740% 24 - C5 -3I68 9.5 PYRD_PLAF7
8 PsiBlast_PDB 63.2641% 38 - C5 -1D3G 10.8 PYRD_HUMAN
22 PsiBlast_CBE 63.2541% 38 - C5 -4IGH 10.7 PYRD_HUMAN
27 PsiBlast_CBE 63.2341% 37 - C5 -4ZMG 10.9 PYRD_HUMAN
35 PsiBlast_CBE 63.1941% 35 - C5 -4LS1 10.2 PYRD_HUMAN
62 PsiBlast_CBE 63.1640% 25 - C5 -4CQA 9.8 PYRD_PLAF7
42 PsiBlast_CBE 63.1141% 37 - C5 -3W7R 10.8 PYRD_HUMAN
25 PsiBlast_CBE 63.0241% 38 - C5 -5HIN 10.6 PYRD_HUMAN
26 PsiBlast_CBE 62.9941% 35 - C5 -5H2Z 10.6 PYRD_HUMAN
33 PsiBlast_CBE 62.6841% 35 - C5 -4RK8 10.1 PYRD_HUMAN
68 PsiBlast_CBE 62.6240% 15 - C5 -3SFK 8.4 PYRD_PLAF7
23 PsiBlast_CBE 62.6241% 31 - C5 -5MVC 10.6 PYRD_HUMAN
72 PsiBlast_CBE 62.4940% 25 - C5 -3I6R 9.4 PYRD_PLAF7
63 PsiBlast_CBE 62.4140% 29 - C5 -4CQA 10.3 PYRD_PLAF7
54 PsiBlast_CBE 62.1741% 34 - C5 -4OQV 11.0 PYRD_HUMAN
11 PsiBlast_PDB 61.8041% 35 - C5 -2PRH 10.6 PYRD_HUMAN
29 PsiBlast_CBE 61.7841% 33 - C5 -4YLW 10.2 PYRD_HUMAN
7 PsiBlast_PDB 61.5441% 30 - C5 -5MUT 10.7 PYRD_HUMAN
49 PsiBlast_CBE 61.4241% 31 - C5 -5MVD 10.6 PYRD_HUMAN
75 PsiBlast_CBE 61.2937% 25 - C5 -1TV5 8.7 PYRD_PLAF7