@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VKC3: (2017-10-26 )
MKKVVVFSQIDEEILSRLQQDYHVVVLNPKLGDINEQIRQEVVDADGMIGAGRLLNESNLSPAQKLKIISSVTVGYDNYDVGYLNQKKIWLANTPHVLTETTADLAFTLLLSAARKVPFLDHWTKQGEWKRTVGPQQFGLDVFGKTLGIIGLGNIGAAIARRGFYGFNMNIVYHNRREKPELAEPLKAQYLGLEELLQQSDFVVTAVGLNAESKALMGKAQFELMQKHAIFINIARGSVVDEQALIEALQNEVIFAAGLDVYEKEPLQESALFNLPNVVTLPHVGSATAETRKKMANLAYKNLVEALEDKTPRYLVNPNFV

Atome Classification :

(33 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NDP_L_12(2GCG)
GRHPR_HUMAN
[Raw transfer]




NDP_J_10(2GCG)
GRHPR_HUMAN
[Raw transfer]




NDP_K_11(2GCG)
GRHPR_HUMAN
[Raw transfer]




NAP_A_7(2DBZ)
GYAR_PYRHO
[Raw transfer]




NAP_A_4(2DBQ)
GYAR_PYRHO
[Raw transfer]




NAP_B_8(2DBZ)
GYAR_PYRHO
[Raw transfer]




NAP_A_2(5AOV)
GYAR_PYRFU
[Raw transfer]




NAP_A_2(5AOV)
GYAR_PYRFU
[Raw transfer]




NAP_A_2(3BAZ)
HPPR_PLESU
[Raw transfer]




A2R_B_11(5J23)
?
[Raw transfer]




8YV_C_23(5V7N)
?
[Raw transfer]




8YV_B_15(5V7N)
?
[Raw transfer]




A2R_A_7(5J23)
?
[Raw transfer]




8YV_A_6(5V7N)
?
[Raw transfer]




MLA_A_6(5V6Q)
?
[Raw transfer]




GOL_A_5(2DBQ)
GYAR_PYRHO
[Raw transfer]




MLA_C_12(5V6Q)
?
[Raw transfer]




GOL_A_7(5V72)
?
[Raw transfer]




GLV_A_3(5AOV)
GYAR_PYRFU
[Raw transfer]




MLA_B_9(5V6Q)
?
[Raw transfer]




MLA_D_14(5V6Q)
?
[Raw transfer]




CIT_C_12(5V72)
?
[Raw transfer]




NHE_E_5(2CUK)
?
[Raw transfer]




GLV_A_23(5AOV)
GYAR_PYRFU
[Raw transfer]




2 PsiBlast_PDB 78.7242% -0 * C2 *5AOW - ? -
101 HHSearch 77.6242% 3 - C2 -5AOW - ? -
3 PsiBlast_PDB 77.0043% 0 - C2 -2DBR - GYAR_PYRHO -
22 PsiBlast_CBE 76.9843% -2 - C2 -2DBZ 8.6 GYAR_PYRHO
23 PsiBlast_CBE 76.6343% 5 - C2 -2DBR - GYAR_PYRHO -
26 PsiBlast_CBE 76.5843% 2 - C2 -2DBR - GYAR_PYRHO -
25 PsiBlast_CBE 76.5343% 1 - C2 -2DBR - GYAR_PYRHO -
21 PsiBlast_CBE 76.5142% 0 - C2 -5AOW - ? -
27 PsiBlast_CBE 76.4743% 2 - C2 -2DBR - GYAR_PYRHO -
24 PsiBlast_CBE 76.4443% -4 - C2 -2DBR - GYAR_PYRHO -
4 PsiBlast_PDB 76.0243% -0 - C2 -2DBZ 9.1 GYAR_PYRHO
90 HHSearch 75.8441% 0 - C2 -5AOV 9.7 GYAR_PYRFU
5 PsiBlast_PDB 73.9642% 1 - C2 -2DBQ 10.7 GYAR_PYRHO
106 HHSearch 72.6634%-100 - C2 -5V7N - ? -
31 PsiBlast_CBE 70.6741% -95 - C2 -2GCG 7.3 GRHPR_HUMAN
42 PsiBlast_CBE 70.5235%-142 - C2 -5J23 - ? -
44 PsiBlast_CBE 70.3535%-142 - C2 -5J23 7.4 ?
11 PsiBlast_PDB 70.1040%-151 - C2 -3BAZ 10.6 HPPR_PLESU
12 PsiBlast_PDB 69.8735%-142 - C2 -5J23 7.2 ?
14 PsiBlast_PDB 69.8135%-143 - C2 -5V7G - ? -
17 PsiBlast_PDB 69.1935%-148 - C2 -5V72 2.5 ?
6 PsiBlast_PDB 69.0641% -91 - C2 -2GCG 7.9 GRHPR_HUMAN
15 PsiBlast_PDB 68.8635%-141 - C2 -5V7N 2.3 ?
39 PsiBlast_CBE 68.2635%-140 - C2 -5V6Q 2.3 ?
32 PsiBlast_CBE 68.0141% -91 - C2 -2GCG 9.2 GRHPR_HUMAN
50 PsiBlast_CBE 67.9641%-145 - C2 -2CUK 2.7 ?
41 PsiBlast_CBE 67.8535%-141 - C2 -5V6Q 2.5 ?
34 PsiBlast_CBE 67.8035%-141 - C2 -5V7N 3.9 ?
13 PsiBlast_PDB 67.7335%-140 - C2 -5V6Q 3.1 ?
1 PsiBlast_PDB 67.7243% 16 - C2 -5AOV 9.7 GYAR_PYRFU
40 PsiBlast_CBE 67.5835%-141 - C2 -5V6Q 2.3 ?
35 PsiBlast_CBE 67.2235%-139 - C2 -5V7N 2.9 ?
47 PsiBlast_CBE 67.2035%-143 - C2 -5V72 3.7 ?