@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VKK5: (2017-10-27 )
MTVTTYIGLGSNLGDSRQILSEAITKLKSLGEVKVSKLYQSPPMGPQDQPNYLNAVAQLKTELLPLELLDQLQRFEQEAGRVRLRHWGERTLDLDLLIYGNEKIQNERLTVPHVGILQRDFVVIPLLDLDADLHINDQPLKNLELIQQPTLTVLADESWA

Atome Classification :

(67 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_C_18(5ETL)
HPPK_ECOLI
[Raw transfer]




A4P_A_4(1EX8)
HPPK_ECOLI
[Raw transfer]




J1D_A_2(4F7V)
HPPK_ECOLI
[Raw transfer]




J1C_A_2(3UDV)
HPPK_ECOLI
[Raw transfer]




HHR_A_5(3IP0)
HPPK_ECOLI
[Raw transfer]




J1B_A_2(3UDE)
HPPK_ECOLI
[Raw transfer]




J1A_A_2(3UD5)
HPPK_ECOLI
[Raw transfer]




HHR_A_5(3IP0)
HPPK_ECOLI
[Raw transfer]




HHR_B_18(1TMM)
HPPK_ECOLI
[Raw transfer]




HHR_A_16(1TMM)
HPPK_ECOLI
[Raw transfer]




PH2_A_6(1F9H)
HPPK_ECOLI
[Raw transfer]




HH2_A_2(1RB0)
HPPK_ECOLI
[Raw transfer]




GSY_A_3(4AD6)
?
[Raw transfer]




GSY_B_4(4AD6)
?
[Raw transfer]




PH2_A_10(1HQ2)
HPPK_ECOLI
[Raw transfer]




5RW_A_2(5ETM)
HPPK_ECOLI
[Raw transfer]




ROI_E_5(1CBK)
HPPK_HAEIN
[Raw transfer]




5RV_D_23(5ETL)
HPPK_ECOLI
[Raw transfer]




B55_A_3(3QBC)
?
[Raw transfer]




ROI_F_6(1CBK)
HPPK_HAEIN
[Raw transfer]




ROI_F_6(1CBK)
HPPK_HAEIN
[Raw transfer]




PH2_B_11(1RU1)
HPPK_ECOLI
[Raw transfer]




B55_B_4(3QBC)
?
[Raw transfer]




PH2_A_4(3ILO)
HPPK_ECOLI
[Raw transfer]




HH2_A_3(1RAO)
HPPK_ECOLI
[Raw transfer]




B55_B_4(3QBC)
?
[Raw transfer]




YH5_A_6(4CRJ)
?
[Raw transfer]




PH2_A_3(3KUH)
HPPK_ECOLI
[Raw transfer]




X6L_A_6(4CWB)
?
[Raw transfer]




5RY_B_4(5ETT)
?
[Raw transfer]




5RW_B_4(5ETR)
?
[Raw transfer]




5RY_A_10(5ETT)
?
[Raw transfer]




5RW_B_4(5ETR)
?
[Raw transfer]




5RW_A_11(5ETR)
?
[Raw transfer]




5RX_A_10(5ETS)
?
[Raw transfer]




5RX_B_4(5ETS)
?
[Raw transfer]




GOL_A_10(3HSD)
HPPK_ECOLI
[Raw transfer]




GOL_A_9(3HSD)
HPPK_ECOLI
[Raw transfer]




GOL_A_5(3HSJ)
HPPK_ECOLI
[Raw transfer]




GOL_A_5(3HSJ)
HPPK_ECOLI
[Raw transfer]




ATP_A_2(1DY3)
HPPK_ECOLI
[Raw transfer]




APC_A_3(5ETM)
HPPK_ECOLI
[Raw transfer]




APC_A_2(4M5J)
HPPK_ECOLI
[Raw transfer]




ATP_A_9(5ETL)
HPPK_ECOLI
[Raw transfer]




APC_A_3(4M5M)
HPPK_ECOLI
[Raw transfer]




ATP_D_22(5ETL)
HPPK_ECOLI
[Raw transfer]




APC_A_4(3HSG)
HPPK_ECOLI
[Raw transfer]




APC_A_3(5ETO)
HPPK_ECOLI
[Raw transfer]




APC_A_2(4M5G)
HPPK_ECOLI
[Raw transfer]




APC_A_5(4M5I)
HPPK_ECOLI
[Raw transfer]




APC_A_2(4M5K)
HPPK_ECOLI
[Raw transfer]




APC_A_4(3HT0)
HPPK_ECOLI
[Raw transfer]




ATP_A_6(5ETN)
HPPK_ECOLI
[Raw transfer]




APC_A_2(4M5H)
HPPK_ECOLI
[Raw transfer]




APC_A_2(5ETP)
HPPK_ECOLI
[Raw transfer]




APC_A_4(3HD2)
HPPK_ECOLI
[Raw transfer]




APC_A_9(1Q0N)
HPPK_ECOLI
[Raw transfer]




APC_A_4(3HD1)
HPPK_ECOLI
[Raw transfer]




ATP_B_13(5ETL)
HPPK_ECOLI
[Raw transfer]




ATP_C_18(5ETL)
HPPK_ECOLI
[Raw transfer]




APC_A_2(4M5L)
HPPK_ECOLI
[Raw transfer]




GOL_A_9(1RTZ)
HPPK_ECOLI
[Raw transfer]




APC_A_5(1RU2)
HPPK_ECOLI
[Raw transfer]




APC_A_8(1RU1)
HPPK_ECOLI
[Raw transfer]




ADP_A_4(1EQM)
HPPK_ECOLI
[Raw transfer]




APC_A_7(2QX0)
?
[Raw transfer]




APC_A_3(3ILJ)
HPPK_ECOLI
[Raw transfer]




TRS_A_4(3HSZ)
HPPK_ECOLI
[Raw transfer]




EDO_A_3(3UD5)
HPPK_ECOLI
[Raw transfer]




TRS_A_3(3HCX)
HPPK_ECOLI
[Raw transfer]




98 Fugue 79.1148% -19 - C5 -1CBK 4.5 HPPK_HAEIN
83 HHSearch 77.9250% -26 - C5 -1CBK 4.5 HPPK_HAEIN
85 HHSearch 76.1142% -31 - C5 -3IP0 5.4 HPPK_ECOLI
84 HHSearch 76.0941% -41 - C5 -3HSJ 2.9 HPPK_ECOLI
60 PsiBlast_CBE 74.9243% -36 - C5 -1RTZ 2.6 HPPK_ECOLI
1 PsiBlast_PDB 74.7657% -26 - C5 -1CBK - HPPK_HAEIN -
21 PsiBlast_CBE 74.2357% -25 - C5 -1CBK 4.5 HPPK_HAEIN
58 PsiBlast_CBE 74.1843% -30 - C5 -1RU1 3.9 HPPK_ECOLI
66 PsiBlast_CBE 73.1540% -44 - C5 -5ETR 4.5 ?
82 HHSearch 73.1043% -37 - C5 -2QX0 2.2 ?
75 PsiBlast_CBE 72.8940% -57 - C5 -3QBC 2.5 ?
62 PsiBlast_CBE 72.0740% -41 - C5 -5ETT 5.1 ?
65 PsiBlast_CBE 72.0240% -42 - C5 -5ETS 5.0 ?
72 PsiBlast_CBE 71.6340% -43 - C5 -4CRJ 4.7 ?
64 PsiBlast_CBE 71.5440% -40 - C5 -5ETS 4.8 ?
67 PsiBlast_CBE 71.4740% -43 - C5 -5ETR 4.7 ?
22 PsiBlast_CBE 71.4647% 10 - C5 -5ETL 6.9 HPPK_ECOLI
73 PsiBlast_CBE 71.3940% -57 - C5 -4AD6 2.8 ?
76 PsiBlast_CBE 71.3840% -50 - C5 -3QBC 3.5 ?
71 PsiBlast_CBE 71.3040% -40 * C5 *4CWB 5.9 ?
63 PsiBlast_CBE 71.2540% -41 - C5 -5ETT 5.1 ?
74 PsiBlast_CBE 70.9540% -55 - C5 -4AD6 3.1 ?
57 PsiBlast_CBE 70.8243% -35 - C5 -1RU2 4.6 HPPK_ECOLI
4 PsiBlast_PDB 70.6247% 15 - C5 -5ETM 6.8 HPPK_ECOLI
12 PsiBlast_PDB 70.5047% 13 - C5 -4M5K 6.9 HPPK_ECOLI
5 PsiBlast_PDB 70.4347% 11 - C5 -5ETN 7.0 HPPK_ECOLI
9 PsiBlast_PDB 70.4147% 12 - C5 -4M5H 6.6 HPPK_ECOLI
13 PsiBlast_PDB 70.2547% 13 - C5 -4M5L 6.9 HPPK_ECOLI
10 PsiBlast_PDB 70.1947% 14 - C5 -4M5I 6.7 HPPK_ECOLI
86 HHSearch 70.0335% -25 - C5 -5ETR 4.6 ?
8 PsiBlast_PDB 70.0147% 15 - C5 -4M5G 6.6 HPPK_ECOLI
7 PsiBlast_PDB 69.9547% 13 - C5 -5ETP 6.9 HPPK_ECOLI
14 PsiBlast_PDB 69.7947% 19 - C5 -4M5M 7.2 HPPK_ECOLI
11 PsiBlast_PDB 69.6447% 25 - C5 -4M5J 6.5 HPPK_ECOLI
48 PsiBlast_CBE 69.5945% 7 - C5 -3HSG 6.1 HPPK_ECOLI
6 PsiBlast_PDB 69.5147% 15 - C5 -5ETO 6.7 HPPK_ECOLI
30 PsiBlast_CBE 69.4545% 21 - C5 -3IP0 5.4 HPPK_ECOLI
16 PsiBlast_PDB 69.2845% 22 - C5 -1DY3 6.9 HPPK_ECOLI
45 PsiBlast_CBE 69.0645% 19 - C5 -3HSJ 2.9 HPPK_ECOLI
40 PsiBlast_CBE 68.9345% 20 - C5 -1F9H 5.1 HPPK_ECOLI
59 PsiBlast_CBE 68.8343% -38 - C5 -1RU1 4.5 HPPK_ECOLI
29 PsiBlast_CBE 68.8045% 19 - C5 -3UD5 7.4 HPPK_ECOLI
47 PsiBlast_CBE 68.7245% 8 - C5 -3HCX 2.7 HPPK_ECOLI
3 PsiBlast_PDB 68.6247% 13 - C5 -5ETL 6.7 HPPK_ECOLI
49 PsiBlast_CBE 68.5545% 17 - C5 -3HSD 2.2 HPPK_ECOLI
87 HHSearch 68.5035% -34 - C5 -3QBC 2.5 ?
55 PsiBlast_CBE 68.4245% 21 - C5 -1TMM 4.6 HPPK_ECOLI
37 PsiBlast_CBE 68.4245% 18 - C5 -1HQ2 4.5 HPPK_ECOLI
32 PsiBlast_CBE 68.4145% 25 - C5 -1RAO 4.1 HPPK_ECOLI
50 PsiBlast_CBE 68.3845% 7 - C5 -3HSD 2.0 HPPK_ECOLI
41 PsiBlast_CBE 68.3345% 21 - C5 -3ILO 4.3 HPPK_ECOLI
17 PsiBlast_PDB 68.2545% 18 - C5 -1EX8 10.8 HPPK_ECOLI
23 PsiBlast_CBE 68.1047% 13 - C5 -5ETL 6.3 HPPK_ECOLI
34 PsiBlast_CBE 68.0545% 21 - C5 -3HD2 5.2 HPPK_ECOLI
53 PsiBlast_CBE 67.9945% 18 - C5 -3HSZ 3.4 HPPK_ECOLI
20 PsiBlast_PDB 67.9645% 22 - C5 -1Q0N 6.9 HPPK_ECOLI
18 PsiBlast_PDB 67.9445% 25 - C5 -1EQM 3.4 HPPK_ECOLI
52 PsiBlast_CBE 67.8445% 19 - C5 -3HT0 5.2 HPPK_ECOLI
46 PsiBlast_CBE 67.8145% 18 - C5 -3HD1 5.3 HPPK_ECOLI
54 PsiBlast_CBE 67.5745% 28 - C5 -1TMM 4.6 HPPK_ECOLI
28 PsiBlast_CBE 67.5645% 32 - C5 -3UDE 8.8 HPPK_ECOLI
43 PsiBlast_CBE 67.1445% 24 - C5 -3ILJ 4.4 HPPK_ECOLI
31 PsiBlast_CBE 66.4445% 31 - C5 -1RB0 4.7 HPPK_ECOLI
51 PsiBlast_CBE 66.4045% 23 - C5 -3KUH 4.6 HPPK_ECOLI
27 PsiBlast_CBE 66.2945% 29 - C5 -3UDV 8.0 HPPK_ECOLI
26 PsiBlast_CBE 66.2945% 26 - C5 -4F7V 9.7 HPPK_ECOLI
24 PsiBlast_CBE 66.0747% 19 - C5 -5ETL 6.9 HPPK_ECOLI