@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VKK8: (2017-10-27 )
MDKLLKIMQELREKCPWDQEQTSMSLTKYAIEEAYEVEAAIRQGDINEIRNELGDLLLQVVFQSQMFSEQGAFNFQDVVEAISEKLVRRHPHVFQADQFNNLIPEQVSELWKQIKQQEKQGKPQSRLDEIKHGPALSQAQEIQKNVAKVGFDFETVEDAYTKLEEELDEFKQALKNQNSDEIQDEFGDCLFSLVNVGRKLGISSESSLLSTIHKFRSRFAFIEEQAIKQQRTLEDMTLSEMDELWNQAKRQLKSGEKPHAIQHEILEK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_B_4(3CRC)
MAZG_ECOLI
[Raw transfer]




10 Fugue 77.4744% 60 - C1 -3CRA - MAZG_ECOLI -
21 HHSearch 76.8743% 19 - C1 -3CRA - MAZG_ECOLI -
20 HHSearch 73.3943% 76 - C1 -3CRA - MAZG_ECOLI -
2 PsiBlast_PDB 73.1743% 25 - C1 -3CRC - MAZG_ECOLI -
1 PsiBlast_PDB 71.0643% 78 - C1 -3CRA - MAZG_ECOLI -
9 PsiBlast_CBE 67.9643% 48 - C1 -3CRC 5.9 MAZG_ECOLI
22 HHSearch 51.3623% -83 - C1 -2YXH - ? -
3 PsiBlast_PDB 50.5422% -78 - C1 -2YXH - ? -
14 Fugue 47.4423% 36 - C1 -5TK8 - ? -
27 HHSearch 46.9124% -33 - C1 -4QGP - ? -
26 HHSearch 46.4824% -37 - C1 -4QGP - ? -
18 Fugue 44.9418% -22 - C1 -5IE9 - ? -
4 PsiBlast_PDB 43.9836% 5 - C1 -1VMG - ? -
15 Fugue 42.6212% 15 - C1 -5EYB - REB1_SCHPO -
32 HHSearch 42.0414% -81 - C1 -1VMG - ? -
33 HHSearch 41.5920% -15 * C1 *5IE9 - ? -
41 HHSearch 39.9924% 26 - C1 -2GTA - YPJD_BACSU -
34 HHSearch 39.4720% 15 - C1 -5IE9 - ? -
28 HHSearch 38.2615% 18 - C1 -2Q5Z - ? -
35 HHSearch 37.6619% -74 - C1 -2Q73 - ? -