@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VKL5: (2017-10-27 )
MSNTQPDFLADEFLLDHYVGKTPLVRLQRLACHTQATVLAKLEGNNPAGSVKDRPAYNMIMQAEKRGQIKPGDTLVEATSGNTGIALAMVAAMRGYKMKLIMPGNSSQERKDAMRAYGAELIEAPNMEAARDMALQMQAEGLGLVLNQFGNPDNVEAHYLTTGPEIWKQTGGKITHFVSSMGTTGTIMGVSKYLKEQNPDIQIIGLHPSEGSNIAGIRRWPQEYLPTIFEPKRVDQIMGIPQIEAEKTARRLAREEGISAGTSSGGAVWASVKIAEENPDAVIVCIICDRGDRYLSTGLFSVQD

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

S16_B_8(5I7O)
CYSM_MYCTU
[Raw transfer]




AU6_C_12(5I6D)
CYSM_MYCTU
[Raw transfer]




68Q_B_7(5I7A)
CYSM_MYCTU
[Raw transfer]




P1T_A_3(3PC3)
?
[Raw transfer]




68V_B_7(5I7H)
CYSM_MYCTU
[Raw transfer]




S16_A_6(5I7O)
CYSM_MYCTU
[Raw transfer]




68V_A_5(5I7H)
CYSM_MYCTU
[Raw transfer]




68Q_A_5(5I7A)
CYSM_MYCTU
[Raw transfer]




AU6_A_6(5I6D)
CYSM_MYCTU
[Raw transfer]




CIT_A_4(2V03)
CYSM_ECOLI
[Raw transfer]




CIT_A_4(2V03)
CYSM_ECOLI
[Raw transfer]




CYS_A_2(4LMB)
?
[Raw transfer]




GOL_A_7(5I6D)
CYSM_MYCTU
[Raw transfer]




ILE_A_3(4IL5)
?
[Raw transfer]




GOL_B_10(5I6D)
CYSM_MYCTU
[Raw transfer]




4AT_B_6(2EFY)
?
[Raw transfer]




CYS_B_11(3BM5)
?
[Raw transfer]




4AT_A_4(2EFY)
?
[Raw transfer]




PLP_B_8(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_D_11(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_A_7(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_C_9(2BHS)
CYSM_ECOLI
[Raw transfer]




4MV_A_3(2ECO)
?
[Raw transfer]




3HL_A_3(2ECQ)
?
[Raw transfer]




MPD_A_6(2Q3B)
CYSK_MYCTU
[Raw transfer]




110 HHSearch 93.3365% -4 - C4 -2V03 2.3 CYSM_ECOLI
3 PsiBlast_PDB 91.9164% -1 - C4 -2V03 2.3 CYSM_ECOLI
21 PsiBlast_CBE 91.3864% -7 - C4 -2BHS 3.7 CYSM_ECOLI
109 HHSearch 91.2863% -5 - C4 -2JC3 - CYSM_SALTY -
27 PsiBlast_CBE 90.9162% -4 - C4 -2JC3 - CYSM_SALTY -
25 PsiBlast_CBE 90.8362% -0 - C4 -2JC3 - CYSM_SALTY -
2 PsiBlast_PDB 90.7564% -4 - C4 -2BHS 3.7 CYSM_ECOLI
26 PsiBlast_CBE 90.7462% -3 - C4 -2JC3 - CYSM_SALTY -
29 PsiBlast_CBE 90.6562% -4 - C4 -2JC3 - CYSM_SALTY -
28 PsiBlast_CBE 90.6362% -4 - C4 -2JC3 - CYSM_SALTY -
30 PsiBlast_CBE 90.5262% -3 - C4 -2JC3 - CYSM_SALTY -
23 PsiBlast_CBE 90.5264% -5 - C4 -2BHS 3.7 CYSM_ECOLI
22 PsiBlast_CBE 90.0564% -0 - C4 -2BHS 3.5 CYSM_ECOLI
24 PsiBlast_CBE 90.0462% -3 - C4 -2JC3 - CYSM_SALTY -
4 PsiBlast_PDB 89.8562% -1 - C4 -2JC3 - CYSM_SALTY -
1 PsiBlast_PDB 87.2764% 3 - C4 -2BHT - CYSM_ECOLI -
132 Fugue 81.1145% -2 - C4 -1OAS - CYSK_SALTY -
118 HHSearch 80.5542% -17 - C4 -2Q3D - CYSK_MYCTU -
111 HHSearch 80.1242% -14 - C4 -2Q3B - CYSK_MYCTU -
115 HHSearch 79.4943% 3 - C4 -2ISQ - CYSK1_ARATH -
51 PsiBlast_CBE 70.5041% 25 - C4 -4LMB 3.3 ?
98 PsiBlast_CBE 67.0636% 15 - C4 -5I6D 4.5 CYSM_MYCTU
97 PsiBlast_CBE 66.2436% 16 - C4 -5I6D 2.8 CYSM_MYCTU