@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VKQ5: (2017-10-28 )
MQFRKTLNIGIMLKIVLSEIGMTQGLLAGKRFLTAGVASKLSIAYGIAQALHREGAELAFTYPNEKLKKRVDEFAEQFGSKLVFPCDVAVDAEIDNAFAELAKHWDGVDGVVHSIGFAPAHTLDGDFTDVTDRDGFKIAHDISAYSFVAMARAAKPLLQARQGCLLTLTYQGSERVMPNYNVMGMAKASLEAGVRYLASSLGVDGIRVNAISAGPIRTLAASGIKSFRKMLDANEKVAPLKRNVTIEEVGNAALFLCSPWASGITGEILYVDAGFNTVGMSQSMMDDE

Atome Classification :

(78 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_D_11(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_G_7(1I30)
FABI_ECOLI
[Raw transfer]




NAD_A_2(5I7S)
?
[Raw transfer]




NAD_B_5(4D46)
?
[Raw transfer]




NAD_A_2(5I9L)
?
[Raw transfer]




NAD_D_11(4NR0)
FABI_PSEAE
[Raw transfer]




NAD_C_9(4NR0)
FABI_PSEAE
[Raw transfer]




NAD_B_5(1C14)
FABI_ECOLI
[Raw transfer]




NAD_A_4(5I9M)
?
[Raw transfer]




NAD_B_7(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_B_5(5CG1)
FABI_ECOLI
[Raw transfer]




NAD_C_8(5I9M)
?
[Raw transfer]




NAD_G_7(1MFP)
FABI_ECOLI
[Raw transfer]




NAD_E_5(1I30)
FABI_ECOLI
[Raw transfer]




NAD_A_4(5I7V)
?
[Raw transfer]




NAD_A_2(5I7S)
?
[Raw transfer]




NAI_A_4(4CV3)
?
[Raw transfer]




NAD_D_11(2PD3)
FABI_HELPY
[Raw transfer]




NAD_B_4(1D8A)
FABI_ECOLI
[Raw transfer]




NAD_G_7(1LXC)
FABI_ECOLI
[Raw transfer]




NAD_A_3(1C14)
FABI_ECOLI
[Raw transfer]




NAD_I_9(1I2Z)
FABI_ECOLI
[Raw transfer]




NAD_A_2(3OIG)
FABI_BACSU
[Raw transfer]




NAD_A_2(5I8Z)
?
[Raw transfer]




NAD_C_9(4NR0)
FABI_PSEAE
[Raw transfer]




NAD_I_9(1MFP)
FABI_ECOLI
[Raw transfer]




NAD_E_5(1LX6)
FABI_ECOLI
[Raw transfer]




NAI_B_5(4CV2)
?
[Raw transfer]




NAD_C_9(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_C_9(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_A_3(4D46)
?
[Raw transfer]




NAD_A_2(5I9N)
?
[Raw transfer]




NAD_B_5(4M89)
?
[Raw transfer]




NAD_B_7(4NR0)
FABI_PSEAE
[Raw transfer]




NAD_A_5(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_A_5(4NR0)
FABI_PSEAE
[Raw transfer]




NAD_A_4(4JX8)
FABI_ECOLI
[Raw transfer]




NAI_B_6(4CV3)
?
[Raw transfer]




NAD_A_2(5I8W)
?
[Raw transfer]




NAD_A_3(1D8A)
FABI_ECOLI
[Raw transfer]




NAD_B_9(1DFG)
FABI_ECOLI
[Raw transfer]




NAI_A_2(4BKU)
?
[Raw transfer]




NAD_A_3(5CG2)
FABI_ECOLI
[Raw transfer]




NAD_A_5(1DFH)
FABI_ECOLI
[Raw transfer]




NAD_B_6(5I9M)
?
[Raw transfer]




NAD_I_9(1LX6)
FABI_ECOLI
[Raw transfer]




NAD_C_8(5I7V)
?
[Raw transfer]




NAD_A_3(3PJD)
FABI_ECOLI
[Raw transfer]




NAD_D_8(2PD4)
FABI_HELPY
[Raw transfer]




NAD_D_8(1DFI)
FABI_ECOLI
[Raw transfer]




NAD_B_5(5CG2)
FABI_ECOLI
[Raw transfer]




NAD_A_3(3PJE)
FABI_ECOLI
[Raw transfer]




NAD_A_2(4ZJU)
?
[Raw transfer]




NAD_A_2(4ZJU)
?
[Raw transfer]




0WE_A_4(4JQC)
FABI_ECOLI
[Raw transfer]




0WE_C_8(4RLH)
?
[Raw transfer]




NAD_B_5(3PJF)
FABI_ECOLI
[Raw transfer]




NAI_A_3(4CV2)
?
[Raw transfer]




NAD_B_6(5I7V)
?
[Raw transfer]




NAD_C_7(1DFI)
FABI_ECOLI
[Raw transfer]




IDN_M_13(1MFP)
FABI_ECOLI
[Raw transfer]




NAD_E_5(1I2Z)
FABI_ECOLI
[Raw transfer]




NAD_A_5(1DFI)
FABI_ECOLI
[Raw transfer]




0WE_B_6(4RLH)
?
[Raw transfer]




IDN_K_11(1MFP)
FABI_ECOLI
[Raw transfer]




NAD_B_9(1DFH)
FABI_ECOLI
[Raw transfer]




NAD_B_5(3PJE)
FABI_ECOLI
[Raw transfer]




NAD_B_5(3PJD)
FABI_ECOLI
[Raw transfer]




NAD_E_5(1LXC)
FABI_ECOLI
[Raw transfer]




AE6_A_3(4JX8)
FABI_ECOLI
[Raw transfer]




NAD_B_10(5TRT)
?
[Raw transfer]




69J_A_3(5I9N)
?
[Raw transfer]




NAD_A_3(5CG1)
FABI_ECOLI
[Raw transfer]




NAD_A_5(1DFG)
FABI_ECOLI
[Raw transfer]




NAD_A_3(4JQC)
FABI_ECOLI
[Raw transfer]




NAD_C_13(5TRT)
?
[Raw transfer]




AYM_K_11(1LXC)
FABI_ECOLI
[Raw transfer]




NAD_A_7(5TRT)
?
[Raw transfer]




NAD_A_7(5TRT)
?
[Raw transfer]




NAD_D_15(5TRT)
?
[Raw transfer]




69K_B_7(5I9M)
?
[Raw transfer]




NAD_A_3(3PJF)
FABI_ECOLI
[Raw transfer]




BBN_B_6(5CG1)
FABI_ECOLI
[Raw transfer]




CJ3_A_4(5CG2)
FABI_ECOLI
[Raw transfer]




NAD_A_5(1DFI)
FABI_ECOLI
[Raw transfer]




NAD_D_5(2JJY)
?
[Raw transfer]




BBN_A_4(5CG1)
FABI_ECOLI
[Raw transfer]




NAD_B_6(1DFI)
FABI_ECOLI
[Raw transfer]




CJ3_B_6(5CG2)
FABI_ECOLI
[Raw transfer]




826_K_11(1I30)
FABI_ECOLI
[Raw transfer]




654_G_7(1I2Z)
FABI_ECOLI
[Raw transfer]




654_K_11(1I2Z)
FABI_ECOLI
[Raw transfer]




J47_B_6(4D46)
?
[Raw transfer]




826_I_9(1I30)
FABI_ECOLI
[Raw transfer]




1 PsiBlast_PDB 97.8399%-127 - C4 -4ZJU 10.9 ?
119 HHSearch 91.3599% -22 - C4 -4ZJU 11.1 ?
55 PsiBlast_CBE 88.0465%-124 - C4 -3PJD 9.9 FABI_ECOLI
35 PsiBlast_CBE 88.0065%-126 - C4 -1I2Z 10.1 FABI_ECOLI
5 PsiBlast_PDB 87.8764%-128 - C4 -4JX8 8.2 FABI_ECOLI
47 PsiBlast_CBE 87.8365%-124 - C4 -1D8A 8.5 FABI_ECOLI
8 PsiBlast_PDB 87.6765%-127 - C4 -1I2Z 10.0 FABI_ECOLI
7 PsiBlast_PDB 87.6665%-125 - C4 -1C14 10.1 FABI_ECOLI
18 PsiBlast_PDB 87.6465%-119 - C4 -1DFH 8.9 FABI_ECOLI
12 PsiBlast_PDB 87.6365%-124 - C4 -1MFP 9.8 FABI_ECOLI
39 PsiBlast_CBE 87.6065%-123 - C4 -1QG6 9.8 FABI_ECOLI
31 PsiBlast_CBE 87.5065%-123 - C4 -1MFP 9.7 FABI_ECOLI
40 PsiBlast_CBE 87.4365%-123 - C4 -1QG6 9.9 FABI_ECOLI
57 PsiBlast_CBE 87.4265%-124 - C4 -3PJE 9.5 FABI_ECOLI
41 PsiBlast_CBE 87.3765%-123 - C4 -1QG6 9.8 FABI_ECOLI
56 PsiBlast_CBE 87.3565%-128 - C4 -3PJD 9.7 FABI_ECOLI
36 PsiBlast_CBE 87.3465%-121 - C4 -1C14 10.3 FABI_ECOLI
20 PsiBlast_PDB 87.3065%-123 - C4 -1QG6 9.9 FABI_ECOLI
4 PsiBlast_PDB 87.3064%-127 - C4 -4JQC 8.5 FABI_ECOLI
17 PsiBlast_PDB 87.1365%-124 - C4 -1DFG 8.8 FABI_ECOLI
59 PsiBlast_CBE 87.1065%-128 - C4 -3PJF 9.5 FABI_ECOLI
58 PsiBlast_CBE 86.6665%-124 - C4 -3PJE 9.8 FABI_ECOLI
45 PsiBlast_CBE 86.5965%-121 - C4 -1DFH 9.1 FABI_ECOLI
49 PsiBlast_CBE 86.1665%-125 - C4 -4D46 10.2 ?
32 PsiBlast_CBE 86.1665%-123 - C4 -1LXC 9.6 FABI_ECOLI
46 PsiBlast_CBE 86.0965%-120 - C4 -1DFG 8.9 FABI_ECOLI
77 PsiBlast_CBE 86.0064%-135 - C4 -5I9N 10.1 ?
48 PsiBlast_CBE 85.9865%-122 - C4 -1D8A 8.4 FABI_ECOLI
23 PsiBlast_CBE 85.8870% -35 - C4 -4NR0 10.3 FABI_PSEAE
9 PsiBlast_PDB 85.8665%-126 - C4 -1I30 9.8 FABI_ECOLI
78 PsiBlast_CBE 85.8164%-133 - C4 -5I9M 9.6 ?
15 PsiBlast_PDB 85.7865%-126 - C4 -5CG1 9.3 FABI_ECOLI
22 PsiBlast_CBE 85.6770% -35 - C4 -4NR0 10.6 FABI_PSEAE
34 PsiBlast_CBE 85.6565%-124 - C4 -1I30 9.0 FABI_ECOLI
80 PsiBlast_CBE 85.5464%-133 - C4 -5I9M 10.3 ?
3 PsiBlast_PDB 85.5470% -34 - C4 -4NR0 9.7 FABI_PSEAE
21 PsiBlast_CBE 85.4970% -36 - C4 -4NR0 9.9 FABI_PSEAE
87 PsiBlast_CBE 85.4864%-131 - C4 -5I7S 10.8 ?
86 PsiBlast_CBE 85.4564%-132 - C4 -5I7V 9.7 ?
100 PsiBlast_CBE 85.4464%-133 - C4 -4BKU 9.8 ?
38 PsiBlast_CBE 85.3365%-129 - C4 -5CG1 9.8 FABI_ECOLI
79 PsiBlast_CBE 85.2864%-133 - C4 -5I9M 8.7 ?
85 PsiBlast_CBE 85.2664%-132 - C4 -5I7V 7.8 ?
82 PsiBlast_CBE 85.2164%-131 - C4 -5I8Z 10.8 ?
83 PsiBlast_CBE 85.1464%-132 - C4 -5I8W 10.2 ?
11 PsiBlast_PDB 85.1165%-128 - C4 -1LXC 9.2 FABI_ECOLI
106 PsiBlast_CBE 84.9964%-132 - C4 -4RLH 7.5 ?
60 PsiBlast_CBE 84.9265%-123 - C4 -3PJF 9.1 FABI_ECOLI
52 PsiBlast_CBE 84.9065%-127 - C4 -4CV3 9.7 ?
101 PsiBlast_CBE 84.8164%-133 - C4 -5TRT 8.3 ?
81 PsiBlast_CBE 84.8064%-131 - C4 -5I9L 9.3 ?
33 PsiBlast_CBE 84.8065%-124 - C4 -1LX6 8.9 FABI_ECOLI
104 PsiBlast_CBE 84.7464%-132 - C4 -5TRT 8.8 ?
84 PsiBlast_CBE 84.7164%-133 - C4 -5I7V 9.0 ?
51 PsiBlast_CBE 84.5465%-127 - C4 -4CV3 9.4 ?
16 PsiBlast_PDB 84.4965%-124 - C4 -5CG2 9.2 FABI_ECOLI
107 PsiBlast_CBE 84.4564%-134 - C4 -4RLH 7.4 ?
37 PsiBlast_CBE 84.4465%-129 - C4 -5CG2 8.7 FABI_ECOLI
19 PsiBlast_PDB 84.4365%-127 - C4 -1DFI 7.5 FABI_ECOLI
102 PsiBlast_CBE 84.4164%-134 - C4 -5TRT 8.4 ?
50 PsiBlast_CBE 84.3865%-129 - C4 -4D46 9.5 ?
43 PsiBlast_CBE 84.3165%-126 - C4 -1DFI 7.5 FABI_ECOLI
44 PsiBlast_CBE 84.1665%-128 - C4 -1DFI 7.0 FABI_ECOLI
42 PsiBlast_CBE 83.8665%-122 - C4 -1DFI 7.6 FABI_ECOLI
53 PsiBlast_CBE 83.8565%-127 - C4 -4CV2 9.2 ?
10 PsiBlast_PDB 83.6565%-129 - C4 -1LX6 8.2 FABI_ECOLI
103 PsiBlast_CBE 83.4664%-137 - C4 -5TRT 8.9 ?
54 PsiBlast_CBE 83.1765%-128 - C4 -4CV2 9.5 ?
121 HHSearch 81.8167% -4 - C4 -4NR0 10.3 FABI_PSEAE
137 HHSearch 81.5265% -41 - C4 -1QG6 10.1 FABI_ECOLI
130 HHSearch 81.3957% -76 * C4 *4M89 10.6 ?
108 PsiBlast_CBE 80.7056%-143 - C4 -2JJY 8.7 ?
126 HHSearch 78.0663% -51 - C4 -5I7S 10.5 ?
120 HHSearch 77.6563% -54 - C4 -5TRT 8.5 ?
139 Fugue 76.2363% -57 - C4 -1DFI 6.5 FABI_ECOLI
133 HHSearch 75.3549% -31 - C4 -3OIG 11.1 FABI_BACSU
132 HHSearch 75.3348% -17 - C4 -2PD4 6.9 FABI_HELPY
131 HHSearch 74.0148% -14 - C4 -2PD3 9.9 FABI_HELPY