@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VKS3: (2017-10-28 )
MAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQADAEGFYAEHKERGFFGDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIRADFAVSIDENAAHGSDSVASAEREIAYFFADNEICPRTR

Atome Classification :

(76 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_5(1WKL)
NDK_THET8
[Raw transfer]




ATP_B_6(1WKL)
NDK_THET8
[Raw transfer]




ADP_R_5(1NLK)
NDK_MYXXA
[Raw transfer]




ADP_R_5(1NLK)
NDK_MYXXA
[Raw transfer]




ADP_A_3(4HR2)
NDK_BURTA
[Raw transfer]




ADP_A_3(4HR2)
NDK_BURTA
[Raw transfer]




ADP_B_4(4HR2)
NDK_BURTA
[Raw transfer]




UDP_D_13(3Q8V)
NDK_STAAC
[Raw transfer]




3AN_B_9(1HIY)
NDKC_DICDI
[Raw transfer]




TYD_A_3(1NDC)
NDKC_DICDI
[Raw transfer]




ADP_A_8(2BEF)
NDKC_DICDI
[Raw transfer]




ADP_B_5(1NDP)
NDKC_DICDI
[Raw transfer]




ADP_A_8(1KDN)
NDKC_DICDI
[Raw transfer]




GDP_G_7(1WKK)
NDK_THET8
[Raw transfer]




ADP_A_3(3NGU)
?
[Raw transfer]




ADP_B_10(1KDN)
NDKC_DICDI
[Raw transfer]




ADP_C_12(1KDN)
NDKC_DICDI
[Raw transfer]




ADP_C_12(2BEF)
NDKC_DICDI
[Raw transfer]




TBD_C_9(1F6T)
NDKC_DICDI
[Raw transfer]




ADP_A_7(3Q8U)
NDK_STAAC
[Raw transfer]




TBD_A_7(1F6T)
NDKC_DICDI
[Raw transfer]




ADP_D_12(3Q8U)
NDK_STAAC
[Raw transfer]




ADP_B_4(3NGU)
?
[Raw transfer]




UDP_A_9(3Q8V)
NDK_STAAC
[Raw transfer]




ADP_B_9(3Q8U)
NDK_STAAC
[Raw transfer]




ADP_I_9(1ZS6)
NDK3_HUMAN
[Raw transfer]




ADP_B_10(2BEF)
NDKC_DICDI
[Raw transfer]




PPS_B_5(1BUX)
NDKC_DICDI
[Raw transfer]




3AN_A_7(1HIY)
NDKC_DICDI
[Raw transfer]




UDP_B_11(3Q8V)
NDK_STAAC
[Raw transfer]




ADP_H_24(3Q8Y)
NDK_STAAC
[Raw transfer]




ADP_A_4(1NDP)
NDKC_DICDI
[Raw transfer]




CDP_B_10(3Q89)
NDK_STAAC
[Raw transfer]




POP_H_8(1B99)
NDKC_DICDI
[Raw transfer]




SON_H_8(1S5Z)
NDKC_DICDI
[Raw transfer]




TBD_B_8(1F6T)
NDKC_DICDI
[Raw transfer]




PPS_C_6(1BUX)
NDKC_DICDI
[Raw transfer]




ADP_D_15(3Q8Y)
NDK_STAAC
[Raw transfer]




ADP_A_9(3Q8Y)
NDK_STAAC
[Raw transfer]




CMP_R_3(1NHK)
NDK_MYXXA
[Raw transfer]




3AN_C_11(1HIY)
NDKC_DICDI
[Raw transfer]




ADP_E_18(3Q8Y)
NDK_STAAC
[Raw transfer]




ADP_C_11(3Q8U)
NDK_STAAC
[Raw transfer]




ADP_F_16(3Q8U)
NDK_STAAC
[Raw transfer]




CMP_L_4(1NHK)
NDK_MYXXA
[Raw transfer]




CMP_L_4(1NHK)
NDK_MYXXA
[Raw transfer]




FUP_G_7(1B99)
NDKC_DICDI
[Raw transfer]




POP_L_12(1B99)
NDKC_DICDI
[Raw transfer]




POP_I_9(1B99)
NDKC_DICDI
[Raw transfer]




POP_J_10(1B99)
NDKC_DICDI
[Raw transfer]




POP_K_11(1B99)
NDKC_DICDI
[Raw transfer]




DG_E_11(3BBB)
NDKB_HUMAN
[Raw transfer]




ADP_B_11(3Q8Y)
NDK_STAAC
[Raw transfer]




DTT_B_6(3NGS)
?
[Raw transfer]




EDO_E_19(5U2I)
?
[Raw transfer]




EDO_B_7(4EK2)
NDK_BURTA
[Raw transfer]




EDO_F_24(5U2I)
?
[Raw transfer]




EDO_F_24(5U2I)
?
[Raw transfer]




DA_E_10(3BBB)
NDKB_HUMAN
[Raw transfer]




2 PsiBlast_PDB 93.26100% -82 - C9 -4S0M - ? -
156 HHSearch 91.61100% -80 - C9 -4S0M - ? -
3 PsiBlast_PDB 89.63100% -88 - C9 -4WBF - NDK_ACIBS -
1 PsiBlast_PDB 87.15100% - - C9 -4W98 - NDK_ACIBS -
150 HHSearch 87.12100% - - C9 -4W98 - NDK_ACIBS -
4 PsiBlast_PDB 86.8477% -92 - C9 -3VGU - ? -
40 PsiBlast_CBE 85.4867% -85 - C9 -5V6D - NDK_NEIG2 -
148 HHSearch 85.1167% -90 - C9 -5V6D - NDK_NEIG2 -
28 PsiBlast_CBE 84.9267% -84 - C9 -5V6D - NDK_NEIG2 -
41 PsiBlast_CBE 84.3767% -82 - C9 -5V6D - NDK_NEIG2 -
8 PsiBlast_PDB 84.3069% -90 - C9 -2HUR - NDK_ECOLI -
7 PsiBlast_PDB 84.3076% -78 - C9 -3VGT - ? -
9 PsiBlast_PDB 84.2667% -87 - C9 -5V6D - NDK_NEIG2 -
6 PsiBlast_PDB 83.2876% -75 - C9 -3VGS - ? -
42 PsiBlast_CBE 82.5967% -82 - C9 -5V6D - NDK_NEIG2 -
45 PsiBlast_CBE 82.5864% -78 - C9 -4HR2 6.0 NDK_BURTA
158 HHSearch 82.2367% -83 - C9 -2NCK - NDK_MYXXA -
5 PsiBlast_PDB 81.6977% -73 - C9 -3VGV - ? -
71 PsiBlast_CBE 81.5948%-109 - C9 -3Q89 5.2 NDK_STAAC
10 PsiBlast_PDB 81.5767% -84 - C9 -2NCK - NDK_MYXXA -
20 PsiBlast_PDB 81.2753%-118 - C9 -1WKK 4.6 NDK_THET8
159 HHSearch 81.0167% -81 - C9 -1NHK 6.1 NDK_MYXXA
155 HHSearch 81.0065% -83 - C9 -4HR2 8.0 NDK_BURTA
52 PsiBlast_CBE 80.7853%-124 - C9 -1WKL 5.8 NDK_THET8
15 PsiBlast_PDB 80.7864% -83 - C9 -4HR2 8.0 NDK_BURTA
12 PsiBlast_PDB 80.4267% -88 - C9 -1NHK 5.9 NDK_MYXXA
44 PsiBlast_CBE 80.2567% -82 - C9 -1NHK 6.1 NDK_MYXXA
62 PsiBlast_CBE 80.0748%-109 - C9 -3Q8V 4.8 NDK_STAAC
46 PsiBlast_CBE 80.0564% -78 - C9 -4EK2 3.3 NDK_BURTA
61 PsiBlast_CBE 80.0048%-113 - C9 -3Q8V 4.8 NDK_STAAC
59 PsiBlast_CBE 79.9948%-112 - C9 -3Q8Y 4.6 NDK_STAAC
53 PsiBlast_CBE 79.9048%-109 - C9 -3Q8Y 4.4 NDK_STAAC
133 PsiBlast_CBE 79.5852%-101 - C9 -1B99 5.2 NDKC_DICDI
138 Fugue 79.3565% -78 - C9 -1NLK 5.8 NDK_MYXXA
116 PsiBlast_CBE 79.3152%-101 - C9 -1KDN 6.6 NDKC_DICDI
69 PsiBlast_CBE 79.2848%-105 - C9 -3Q8U 6.4 NDK_STAAC
131 PsiBlast_CBE 79.2152%-100 - C9 -1B99 2.0 NDKC_DICDI
51 PsiBlast_CBE 79.1853%-127 - C9 -1WKL 5.4 NDK_THET8
115 PsiBlast_CBE 79.1552%-102 - C9 -1NDC 6.8 NDKC_DICDI
64 PsiBlast_CBE 79.1548%-106 - C9 -3Q8U 6.0 NDK_STAAC
60 PsiBlast_CBE 79.0148%-110 - C9 -3Q8Y 6.8 NDK_STAAC
66 PsiBlast_CBE 78.7048%-111 - C9 -3Q8U 6.5 NDK_STAAC
63 PsiBlast_CBE 78.7048%-109 - C9 -3Q8V 5.5 NDK_STAAC
118 PsiBlast_CBE 78.5352%-101 - C9 -1KDN 7.3 NDKC_DICDI
122 PsiBlast_CBE 78.4152%-102 - C9 -1F6T 6.7 NDKC_DICDI
107 PsiBlast_CBE 78.2552%-102 - C9 -2BEF 7.0 NDKC_DICDI
160 HHSearch 78.2049%-115 * C9 *1ZS6 6.2 NDK3_HUMAN
113 PsiBlast_CBE 78.1652%-101 - C9 -1NDP 7.3 NDKC_DICDI
11 PsiBlast_PDB 78.0667% -82 - C9 -1NLK 5.8 NDK_MYXXA
130 PsiBlast_CBE 77.9652%-105 - C9 -1B99 3.7 NDKC_DICDI
117 PsiBlast_CBE 77.8252%-103 - C9 -1KDN 6.5 NDKC_DICDI
132 PsiBlast_CBE 77.6852% -99 - C9 -1B99 3.2 NDKC_DICDI
67 PsiBlast_CBE 77.6448%-108 - C9 -3Q8U 6.2 NDK_STAAC
57 PsiBlast_CBE 77.6148%-107 - C9 -3Q8Y 4.8 NDK_STAAC
56 PsiBlast_CBE 77.5948%-110 - C9 -3Q8Y 5.7 NDK_STAAC
68 PsiBlast_CBE 77.4548% -98 - C9 -3Q8U 6.3 NDK_STAAC
109 PsiBlast_CBE 77.3152% -97 - C9 -2BEF 7.1 NDKC_DICDI
129 PsiBlast_CBE 77.1652%-102 - C9 -1B99 3.3 NDKC_DICDI
128 PsiBlast_CBE 77.1652% -97 - C9 -1B99 3.4 NDKC_DICDI
112 PsiBlast_CBE 77.1052%-107 - C9 -1S5Z 5.3 NDKC_DICDI
125 PsiBlast_CBE 77.0952%-103 - C9 -1BUX 5.2 NDKC_DICDI
120 PsiBlast_CBE 76.8952%-102 - C9 -1HIY 4.9 NDKC_DICDI
167 HHSearch 76.7246%-105 - C9 -3BBB 5.1 NDKB_HUMAN
108 PsiBlast_CBE 76.6752%-103 - C9 -2BEF 6.5 NDKC_DICDI
119 PsiBlast_CBE 76.6352%-106 - C9 -1HIY 5.3 NDKC_DICDI
124 PsiBlast_CBE 76.1752% -98 - C9 -1F6T 7.1 NDKC_DICDI
114 PsiBlast_CBE 75.9352% -98 - C9 -1NDP 6.8 NDKC_DICDI
74 PsiBlast_CBE 75.9150% -96 - C9 -3NGU 5.6 ?
135 PsiBlast_CBE 75.7350% -92 - C9 -5U2I 2.6 ?
153 HHSearch 75.5950% -99 - C9 -5U2I 3.3 ?
126 PsiBlast_CBE 75.5652%-100 - C9 -1BUX 5.3 NDKC_DICDI
134 PsiBlast_CBE 75.5050% -97 - C9 -5U2I 3.3 ?
123 PsiBlast_CBE 75.3552% -95 - C9 -1F6T 6.9 NDKC_DICDI
75 PsiBlast_CBE 74.9550% -96 - C9 -3NGU 8.0 ?
90 PsiBlast_CBE 74.1450% -97 - C9 -3NGS 1.8 ?
121 PsiBlast_CBE 72.9752% -97 - C9 -1HIY 5.7 NDKC_DICDI