@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VL69: (2017-10-31 )
MRAYLDLLQHILDNGGDKGDRTGTGTRSVFGHQMRFDLSKGFPLLTTKKVHFRSIVIELLWFLKGDTNVKYLQDNKVTIWDEWATAEQTARFGRPEHELGPVYGHQWRNFGATKNADGTYNQDGFDQIKWLINEIKTNPNSRRLIVSGWNPNEAGQVALPPCHTLFQFFVQDNKLSCQLYQRSADVFLGVPFNIASYALLTHMIAQVCGLGVGDFVWTGGDIHLYANHFEQAKLQLMREPLPLCQLKLNPDVKDIFDFKFEDIEIVGYESHPAIKAPVAV

Atome Classification :

(100 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PFG_A_4(2BBQ)
TYSY_ECOLI
[Raw transfer]




CB3_B_8(1TDU)
TYSY_ECOLI
[Raw transfer]




CB3_A_6(1DDU)
TYSY_ECOLI
[Raw transfer]




CB3_B_8(1DDU)
TYSY_ECOLI
[Raw transfer]




CB3_E_5(1TRG)
TYSY_ECOLI
[Raw transfer]




CB3_A_6(1TDU)
TYSY_ECOLI
[Raw transfer]




F89_A_6(1TSD)
TYSY_ECOLI
[Raw transfer]




D16_F_6(2KCE)
TYSY_ECOLI
[Raw transfer]




D16_D_4(2KCE)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(2TSC)
TYSY_ECOLI
[Raw transfer]




PFG_B_6(2BBQ)
TYSY_ECOLI
[Raw transfer]




FOZ_B_7(3UWL)
TYSY_ENTFA
[Raw transfer]




CB3_A_4(2TSC)
TYSY_ECOLI
[Raw transfer]




DHF_A_3(4EZ8)
TYSY_MOUSE
[Raw transfer]




NDU_A_3(3B5B)
TYSY_ECOLI
[Raw transfer]




F89_A_4(1TLC)
TYSY_ECOLI
[Raw transfer]




MTX_B_6(1AXW)
TYSY_ECOLI
[Raw transfer]




F89_E_4(1SYN)
TYSY_ECOLI
[Raw transfer]




F89_B_6(1TLC)
TYSY_ECOLI
[Raw transfer]




F89_F_6(1SYN)
TYSY_ECOLI
[Raw transfer]




MTX_A_4(1AXW)
TYSY_ECOLI
[Raw transfer]




F89_B_8(1TSD)
TYSY_ECOLI
[Raw transfer]




D16_F_6(1RTS)
TYSY_RAT
[Raw transfer]




D16_G_7(1HVY)
TYSY_HUMAN
[Raw transfer]




UMP_C_3(1BID)
TYSY_ECOLI
[Raw transfer]




UMP_C_7(1J3K)
?
[Raw transfer]




DGP_B_5(1TLC)
TYSY_ECOLI
[Raw transfer]




UMP_B_11(5BY6)
?
[Raw transfer]




UMP_D_10(1J3I)
?
[Raw transfer]




DGP_A_3(1TLC)
TYSY_ECOLI
[Raw transfer]




UMP_A_3(2VET)
TYSY_ECOLI
[Raw transfer]




NDN_B_4(3B5B)
TYSY_ECOLI
[Raw transfer]




UMP_A_3(5H39)
TYSY_HHV8P
[Raw transfer]




UMP_A_5(5BY6)
?
[Raw transfer]




LYA_A_4(4FQS)
TYSY_MYCTU
[Raw transfer]




CB3_B_6(1AN5)
TYSY_ECOLI
[Raw transfer]




CB3_A_5(1AN5)
TYSY_ECOLI
[Raw transfer]




UFP_C_3(1VZC)
TYSY_LACCA
[Raw transfer]




DUR_E_5(1BDU)
TYSY_ECOLI
[Raw transfer]




DDU_E_5(1AOB)
TYSY_ECOLI
[Raw transfer]




NDU_A_3(3BFI)
TYSY_ECOLI
[Raw transfer]




LYD_D_4(1JUT)
TYSY_ECOLI
[Raw transfer]




GOL_A_5(1F4B)
TYSY_ECOLI
[Raw transfer]




GOL_D_(2A9W)
TYSY_ECOLI
[Raw transfer]




CIT_A_5(3V8H)
?
[Raw transfer]




CB3_A_4(4GEV)
TYSY_ECOLI
[Raw transfer]




CB3_A_4(4KNZ)
TYSY_ECOLI
[Raw transfer]




CB3_A_4(1BQ1)
TYSY_ECOLI
[Raw transfer]




C2F_B_6(1TLS)
TYSY_ECOLI
[Raw transfer]




CB3_B_7(4KNZ)
TYSY_ECOLI
[Raw transfer]




CB3_D_4(1DNA)
TYSY_ECOLI
[Raw transfer]




THG_A_4(3BHL)
TYSY_ECOLI
[Raw transfer]




C2F_G_7(1TSN)
TYSY_ECOLI
[Raw transfer]




CB3_X_5(2FTO)
TYSY_ECOLI
[Raw transfer]




LY3_F_6(1JTQ)
TYSY_ECOLI
[Raw transfer]




LYB_F_6(1JTU)
TYSY_ECOLI
[Raw transfer]




THG_B_8(3BHL)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(1BQ1)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(4GEV)
TYSY_ECOLI
[Raw transfer]




THG_A_3(3BHR)
TYSY_ECOLI
[Raw transfer]




CB3_A_4(1ZPR)
TYSY_ECOLI
[Raw transfer]




CB3_A_4(1KCE)
TYSY_ECOLI
[Raw transfer]




DHF_A_3(1TYS)
TYSY_ECOLI
[Raw transfer]




C2F_A_4(1TLS)
TYSY_ECOLI
[Raw transfer]




MEF_A_5(3BGX)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(1KCE)
TYSY_ECOLI
[Raw transfer]




CB3_F_6(1DNA)
TYSY_ECOLI
[Raw transfer]




CB3_D_4(1NCE)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(1AIQ)
TYSY_ECOLI
[Raw transfer]




LY3_D_4(1JTQ)
TYSY_ECOLI
[Raw transfer]




F89_A_4(2VF0)
TYSY_ECOLI
[Raw transfer]




CB3_A_4(1AIQ)
TYSY_ECOLI
[Raw transfer]




THG_G_7(1KZI)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(1ZPR)
TYSY_ECOLI
[Raw transfer]




TMF_A_3(1BJG)
TYSY_ECOLI
[Raw transfer]




CB3_E_5(1FWM)
TYSY_ECOLI
[Raw transfer]




CB3_F_6(1NCE)
TYSY_ECOLI
[Raw transfer]




THG_J_10(1KZI)
TYSY_ECOLI
[Raw transfer]




CB3_F_6(1FWM)
TYSY_ECOLI
[Raw transfer]




LYD_F_6(1JUT)
TYSY_ECOLI
[Raw transfer]




F89_B_6(2VF0)
TYSY_ECOLI
[Raw transfer]




NDU_A_4(3B9H)
TYSY_ECOLI
[Raw transfer]




DDT_A_4(1JG0)
TYSY_ECOLI
[Raw transfer]




DDT_B_6(1JG0)
TYSY_ECOLI
[Raw transfer]




LYB_D_4(1JTU)
TYSY_ECOLI
[Raw transfer]




TP2_A_7(1F4D)
TYSY_ECOLI
[Raw transfer]




DTT_A_8(2G8X)
TYSY_ECOLI
[Raw transfer]




DTT_B_9(2G8X)
TYSY_ECOLI
[Raw transfer]




TP2_B_9(1F4C)
TYSY_ECOLI
[Raw transfer]




GA9_C_25(2A9W)
TYSY_ECOLI
[Raw transfer]




GA9_B_22(2A9W)
TYSY_ECOLI
[Raw transfer]




GA9_A_18(2A9W)
TYSY_ECOLI
[Raw transfer]




TP2_A_8(1F4C)
TYSY_ECOLI
[Raw transfer]




TP3_A_8(1F4F)
TYSY_ECOLI
[Raw transfer]




TP2_B_8(1F4D)
TYSY_ECOLI
[Raw transfer]




TPR_A_6(1F4E)
TYSY_ECOLI
[Raw transfer]




TP3_B_9(1F4F)
TYSY_ECOLI
[Raw transfer]




11 PsiBlast_PDB 93.3360%-145 - C6 -1AXW 6.5 TYSY_ECOLI
10 PsiBlast_PDB 93.2660%-144 - C6 -1AN5 7.9 TYSY_ECOLI
9 PsiBlast_PDB 93.2060%-141 - C6 -1TDU 7.4 TYSY_ECOLI
128 HHSearch 93.1161%-147 * C6 *4FOX - TYSY_MYCTU -
7 PsiBlast_PDB 93.0260%-146 - C6 -1TSD 7.4 TYSY_ECOLI
3 PsiBlast_PDB 93.0260%-147 - C6 -2KCE 7.0 TYSY_ECOLI
15 PsiBlast_PDB 92.9660%-148 - C6 -1TRG 7.5 TYSY_ECOLI
6 PsiBlast_PDB 92.9060%-145 - C6 -1TLC 8.8 TYSY_ECOLI
30 PsiBlast_CBE 92.8660%-143 - C6 -2TSC 7.3 TYSY_ECOLI
1 PsiBlast_PDB 92.7263%-185 - C6 -3IX6 - TYSY_BRUME -
129 HHSearch 92.6161%-145 - C6 -4FQS 5.8 TYSY_MYCTU
118 HHSearch 92.2363%-145 - C6 -1TJS - TYSY_ECOLI -
17 PsiBlast_PDB 92.2360%-143 - C6 -2TSC 7.4 TYSY_ECOLI
2 PsiBlast_PDB 92.1960%-141 - C6 -2BBQ 7.2 TYSY_ECOLI
104 Fugue 92.1552% 0 - C- -1QZF - ? -
8 PsiBlast_PDB 92.1060%-140 - C6 -1DDU 6.0 TYSY_ECOLI
12 PsiBlast_PDB 91.9460%-144 - C6 -1BDU 3.2 TYSY_ECOLI
19 PsiBlast_PDB 91.9159%-143 - C6 -3B5B 4.8 TYSY_ECOLI
5 PsiBlast_PDB 91.8460%-145 - C6 -1AOB 3.4 TYSY_ECOLI
4 PsiBlast_PDB 91.8460%-142 - C6 -3TMS - TYSY_ECOLI -
27 PsiBlast_CBE 91.7560%-144 - C6 -1DDU 6.4 TYSY_ECOLI
16 PsiBlast_PDB 91.7160%-143 - C6 -1SYN 7.9 TYSY_ECOLI
29 PsiBlast_CBE 91.5360%-146 - C6 -1AN5 7.9 TYSY_ECOLI
22 PsiBlast_CBE 91.4760%-144 - C6 -2BBQ 7.3 TYSY_ECOLI
31 PsiBlast_CBE 91.4159%-141 - C6 -3B5B 5.9 TYSY_ECOLI
24 PsiBlast_CBE 91.3760%-143 - C6 -1TLC 8.8 TYSY_ECOLI
28 PsiBlast_CBE 91.3560%-143 - C6 -1AXW 5.7 TYSY_ECOLI
13 PsiBlast_PDB 91.3460%-147 - C6 -1BID 5.0 TYSY_ECOLI
21 PsiBlast_CBE 90.8960%-143 - C6 -2KCE 6.5 TYSY_ECOLI
26 PsiBlast_CBE 90.8160%-143 - C6 -1SYN 8.5 TYSY_ECOLI
18 PsiBlast_PDB 90.7659%-144 - C6 -2VET 4.7 TYSY_ECOLI
23 PsiBlast_CBE 90.5960%-146 - C6 -1TSD 8.1 TYSY_ECOLI
25 PsiBlast_CBE 90.4660%-144 - C6 -1TDU 7.3 TYSY_ECOLI
125 HHSearch 85.3060% -38 - C6 -3UWL 5.6 TYSY_ENTFA
124 HHSearch 82.0560% -32 - C6 -1VZC 4.3 TYSY_LACCA
117 HHSearch 80.7754% -44 - C6 -4EZ8 4.6 TYSY_MOUSE
121 HHSearch 80.7054% -41 - C6 -1HVY 5.1 TYSY_HUMAN
114 HHSearch 80.0349% -55 - C6 -1J3K 5.4 ?
116 HHSearch 79.9650% -53 - C6 -5H39 5.4 TYSY_HHV8P
115 HHSearch 79.4149% -55 - C6 -1J3I 5.4 ?
130 HHSearch 78.3953% -38 - C6 -1RTS 5.4 TYSY_RAT
119 HHSearch 74.1949% -20 - C6 -5BY6 5.6 ?
120 HHSearch 73.9049% -28 - C6 -5BY6 5.5 ?
132 HHSearch 69.7438% -22 - C6 -3V8H 2.2 ?
91 PsiBlast_CBE 65.1159% -23 - C6 -3BFI Error TYSY_ECOLI
58 PsiBlast_CBE 64.7559% -20 - C6 -1JUT Error TYSY_ECOLI
79 PsiBlast_CBE 60.8459% -25 - C6 -1FWM 5.0 TYSY_ECOLI
72 PsiBlast_CBE 60.4159% -22 - C6 -1ZPR 4.5 TYSY_ECOLI
87 PsiBlast_CBE 60.1159% -22 - C6 -1AIQ 2.1 TYSY_ECOLI
61 PsiBlast_CBE 60.0759% -27 - C6 -1JTQ 3.6 TYSY_ECOLI
32 PsiBlast_CBE 59.8459% -25 - C6 -4KNZ 2.9 TYSY_ECOLI
83 PsiBlast_CBE 59.4859% -24 - C6 -4GEV 4.3 TYSY_ECOLI
93 PsiBlast_CBE 59.4759% -19 - C6 -1TYS 1.8 TYSY_ECOLI
57 PsiBlast_CBE 59.3559% -27 - C6 -1JUT 2.2 TYSY_ECOLI
56 PsiBlast_CBE 59.3459% -25 - C6 -1KCE 2.7 TYSY_ECOLI
59 PsiBlast_CBE 59.3159% -25 - C6 -1JTU 0.7 TYSY_ECOLI
54 PsiBlast_CBE 59.3159% -27 - C6 -1KZI 2.8 TYSY_ECOLI
44 PsiBlast_CBE 59.0859% -22 - C6 -3BHL 2.9 TYSY_ECOLI
45 PsiBlast_CBE 59.0059% -24 - C6 -3B9H Error TYSY_ECOLI
80 PsiBlast_CBE 58.8559% -24 - C6 -1FWM 5.5 TYSY_ECOLI
52 PsiBlast_CBE 58.8159% -24 - C6 -1TLS 5.7 TYSY_ECOLI
43 PsiBlast_CBE 58.7759% -23 - C6 -3BHL 1.8 TYSY_ECOLI
20 PsiBlast_PDB 58.7759% -21 - C6 -1KCE 3.9 TYSY_ECOLI
84 PsiBlast_CBE 58.7459% -25 - C6 -4GEV 2.7 TYSY_ECOLI
42 PsiBlast_CBE 58.7159% -24 - C6 -3BHR 1.6 TYSY_ECOLI
85 PsiBlast_CBE 58.6759% -24 - C6 -2G8X 2.0 TYSY_ECOLI
64 PsiBlast_CBE 58.5759% -25 - C6 -1F4F 1.0 TYSY_ECOLI
50 PsiBlast_CBE 58.5559% -24 - C6 -2A9W 5.8 TYSY_ECOLI
77 PsiBlast_CBE 58.5159% -25 - C6 -1DNA 3.6 TYSY_ECOLI
51 PsiBlast_CBE 58.5059% -18 - C6 -1TSN 3.9 TYSY_ECOLI
86 PsiBlast_CBE 58.4759% -24 - C6 -2G8X 2.0 TYSY_ECOLI
74 PsiBlast_CBE 58.4659% -22 - C6 -2FTO 3.7 TYSY_ECOLI
94 PsiBlast_CBE 58.4459% -26 - C6 -1NCE 1.4 TYSY_ECOLI
55 PsiBlast_CBE 58.4459% -26 - C6 -1KZI 3.0 TYSY_ECOLI
81 PsiBlast_CBE 58.3459% -28 - C6 -1JG0 4.8 TYSY_ECOLI
76 PsiBlast_CBE 58.3459% -22 - C6 -1DNA 3.5 TYSY_ECOLI
33 PsiBlast_CBE 58.3459% -24 - C6 -4KNZ 3.3 TYSY_ECOLI
88 PsiBlast_CBE 58.3059% -23 - C6 -1AIQ 3.1 TYSY_ECOLI
70 PsiBlast_CBE 58.2959% -27 - C6 -2VF0 4.2 TYSY_ECOLI
78 PsiBlast_CBE 58.1459% -27 - C6 -1BJG 2.5 TYSY_ECOLI
92 PsiBlast_CBE 57.9959% -22 - C6 -3BGX 0.9 TYSY_ECOLI
67 PsiBlast_CBE 57.9859% -25 - C6 -1F4C 1.6 TYSY_ECOLI
63 PsiBlast_CBE 57.9159% -26 - C6 -1F4F 0.8 TYSY_ECOLI
89 PsiBlast_CBE 57.9059% -20 - C6 -1BQ1 1.4 TYSY_ECOLI
47 PsiBlast_CBE 57.8559% -22 - C6 -2A9W 0.6 TYSY_ECOLI
66 PsiBlast_CBE 57.8259% -22 - C6 -1F4C 2.4 TYSY_ECOLI
82 PsiBlast_CBE 57.8059% -27 - C6 -1JG0 5.2 TYSY_ECOLI
65 PsiBlast_CBE 57.7859% -25 - C6 -1F4E 3.0 TYSY_ECOLI
49 PsiBlast_CBE 57.7459% -25 - C6 -2A9W 4.2 TYSY_ECOLI
60 PsiBlast_CBE 57.7359% -25 - C6 -1JTU 2.5 TYSY_ECOLI
48 PsiBlast_CBE 57.4659% -26 - C6 -2A9W 4.6 TYSY_ECOLI
53 PsiBlast_CBE 57.4259% -17 - C6 -1TLS 2.3 TYSY_ECOLI
95 PsiBlast_CBE 57.4059% -24 - C6 -1NCE 2.6 TYSY_ECOLI
90 PsiBlast_CBE 57.3759% -16 - C6 -1BQ1 4.2 TYSY_ECOLI
68 PsiBlast_CBE 57.2459% -25 - C6 -1F4B 1.2 TYSY_ECOLI
102 PsiBlast_CBE 57.0259% -21 - C6 -1F4D 1.6 TYSY_ECOLI
103 PsiBlast_CBE 56.6459% -24 - C6 -1F4D 2.0 TYSY_ECOLI
71 PsiBlast_CBE 56.5959% -24 - C6 -2VF0 2.9 TYSY_ECOLI
62 PsiBlast_CBE 56.5959% -21 - C6 -1JTQ 3.2 TYSY_ECOLI
73 PsiBlast_CBE 56.4659% -21 - C6 -1ZPR 3.2 TYSY_ECOLI