@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VLH2: (2017-11-02 )
MHIAALHQPSQVQLNQDGNLKHFLTIEGLSKENLTKILDTAQSFLDDNNNLINRPLLEGRTVMNLFFENSTRTRTTFEAAAKRLSANVLNIDIARSSTSKGETLRDTLWNLEAMAADIFVVRHSSSGAAHFIAKDVCPKVAIINAGDGRHAHPTQAMLDMLTIRREMKKPFEDLSVAIIGDIKHSRVARSDVAALQTLGCKDIRVIAPNTLLPVGFSEYGDHVRLFNNMDEGITGCDVIIALRIQNERIDSPALSSQSEFYRMYGLNKERLSLAKPDCIVMHPGPMNRGVEIDSSIADGEQSVILKQVTNGIAVRMAVLALSMQGQLQEQGLIDAIAL

Atome Classification :

(74 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

6PR_A_8(2H3E)
PYRB_ECOLI
[Raw transfer]




PAL_B_5(4BJH)
PYRB_AQUAE
[Raw transfer]




PAL_C_8(1D09)
PYRB_ECOLI
[Raw transfer]




PAL_A_5(4KGX)
?
[Raw transfer]




PAL_B_7(1EKX)
PYRB_ECOLI
[Raw transfer]




PAL_A_7(1D09)
PYRB_ECOLI
[Raw transfer]




6PR_C_7(2H3E)
PYRB_ECOLI
[Raw transfer]




PAL_C_8(4F04)
PYRB_ECOLI
[Raw transfer]




PAL_C_8(4KGX)
?
[Raw transfer]




PAL_C_8(1EKX)
PYRB_ECOLI
[Raw transfer]




PAL_C_8(4KGV)
?
[Raw transfer]




PAL_A_5(4KGV)
?
[Raw transfer]




PAL_A_6(1EKX)
PYRB_ECOLI
[Raw transfer]




PAL_C_7(1TTH)
PYRB_ECOLI
[Raw transfer]




PAL_A_5(4KH0)
?
[Raw transfer]




PAL_D_4(1ML4)
PYRB_PYRAB
[Raw transfer]




PAL_B_5(4BJH)
PYRB_AQUAE
[Raw transfer]




PAL_C_8(8ATC)
PYRB_ECOLI
[Raw transfer]




PAL_C_11(4KH1)
?
[Raw transfer]




PAL_C_10(4KH0)
?
[Raw transfer]




PAL_A_5(4F04)
PYRB_ECOLI
[Raw transfer]




PAL_A_5(4KH1)
?
[Raw transfer]




PAL_A_7(8ATC)
PYRB_ECOLI
[Raw transfer]




CP_A_4(3R7F)
PYRB_BACSU
[Raw transfer]




1IP_A_7(2IPO)
PYRB_ECOLI
[Raw transfer]




PAL_C_8(1F1B)
PYRB_ECOLI
[Raw transfer]




1IP_C_9(2IPO)
PYRB_ECOLI
[Raw transfer]




CP_A_4(3R7F)
PYRB_BACSU
[Raw transfer]




CP_C_16(3R7F)
PYRB_BACSU
[Raw transfer]




CP_A_10(1ZA2)
PYRB_ECOLI
[Raw transfer]




PAL_A_7(1F1B)
PYRB_ECOLI
[Raw transfer]




EOP_A_7(2FZC)
PYRB_ECOLI
[Raw transfer]




CP_C_11(1ZA2)
PYRB_ECOLI
[Raw transfer]




PCT_A_9(2AT1)
PYRB_ECOLI
[Raw transfer]




PCT_C_10(2HSE)
PYRB_ECOLI
[Raw transfer]




PCT_A_9(7AT1)
PYRB_ECOLI
[Raw transfer]




PCT_A_7(1TU0)
PYRB_ECOLI
[Raw transfer]




CP_B_11(3R7F)
PYRB_BACSU
[Raw transfer]




PCT_C_8(3AT1)
PYRB_ECOLI
[Raw transfer]




EOB_C_10(2FZG)
PYRB_ECOLI
[Raw transfer]




EOB_A_9(2FZG)
PYRB_ECOLI
[Raw transfer]




PCT_A_7(3AT1)
PYRB_ECOLI
[Raw transfer]




EOP_C_8(2FZC)
PYRB_ECOLI
[Raw transfer]




PCT_C_9(1TUG)
PYRB_ECOLI
[Raw transfer]




PCT_A_6(2HSE)
PYRB_ECOLI
[Raw transfer]




PCT_C_8(1TU0)
PYRB_ECOLI
[Raw transfer]




PCT_A_7(2A0F)
PYRB_ECOLI
[Raw transfer]




EOZ_A_7(2FZK)
PYRB_ECOLI
[Raw transfer]




PG4_A_4(3LXM)
PYRB_YERPE
[Raw transfer]




ASP_A_7(2HSE)
PYRB_ECOLI
[Raw transfer]




AL0_G_9(2AIR)
PYRB_ECOLI
[Raw transfer]




NCD_G_10(1R0C)
PYRB_ECOLI
[Raw transfer]




NCD_A_9(1R0C)
PYRB_ECOLI
[Raw transfer]




AL0_A_10(2AIR)
PYRB_ECOLI
[Raw transfer]




PCT_A_10(1TUG)
PYRB_ECOLI
[Raw transfer]




MAL_C_6(2AT1)
PYRB_ECOLI
[Raw transfer]




MAL_A_5(8AT1)
PYRB_ECOLI
[Raw transfer]




MAL_C_6(7AT1)
PYRB_ECOLI
[Raw transfer]




MAL_C_6(8AT1)
PYRB_ECOLI
[Raw transfer]




ASP_A_9(2HSE)
PYRB_ECOLI
[Raw transfer]




149 HHSearch 96.9543%-107 - C7 -3R7F 4.5 PYRB_BACSU
3 PsiBlast_PDB 93.0243% -64 - C7 -3R7F 4.5 PYRB_BACSU
27 PsiBlast_CBE 92.3743% -66 - C7 -3R7F 3.5 PYRB_BACSU
26 PsiBlast_CBE 91.3843% -64 - C7 -3R7F 4.2 PYRB_BACSU
2 PsiBlast_PDB 91.0243% -68 - C7 -3R7D - PYRB_BACSU -
25 PsiBlast_CBE 90.2343% -58 - C7 -3R7L - PYRB_BACSU -
24 PsiBlast_CBE 90.1143% -55 - C7 -3R7L - PYRB_BACSU -
21 PsiBlast_CBE 89.9643% -56 - C7 -3R7L - PYRB_BACSU -
4 PsiBlast_PDB 89.9543% -59 - C7 -3R7L - PYRB_BACSU -
23 PsiBlast_CBE 89.6743% -60 - C7 -3R7L - PYRB_BACSU -
22 PsiBlast_CBE 89.4843% -55 - C7 -3R7L - PYRB_BACSU -
1 PsiBlast_PDB 84.6743% - - C7 -2AT2 - PYRB_BACSU -
148 HHSearch 83.5843% - - C7 -2AT2 - PYRB_BACSU -
12 PsiBlast_PDB 81.7532% -78 - C7 -5G1O - PYR1_HUMAN -
52 PsiBlast_CBE 81.2532% -77 - C7 -5G1O - PYR1_HUMAN -
151 HHSearch 80.4530% -72 - C7 -5G1O - -
48 PsiBlast_CBE 80.3932% -85 - C7 -5G1P - PYR1_HUMAN -
150 HHSearch 80.3530% -69 - C7 -5G1N - PYR1_HUMAN -
46 PsiBlast_CBE 80.2632% -87 - C7 -5G1P - PYR1_HUMAN -
51 PsiBlast_CBE 80.2432% -75 - C7 -5G1O - PYR1_HUMAN -
114 PsiBlast_CBE 77.9731% -76 - C7 -3LXM 2.4 PYRB_YERPE
165 HHSearch 77.7136% -48 - C7 -4BJH 6.2 PYRB_AQUAE
82 PsiBlast_CBE 76.7133% -13 - C7 -2FZG 5.1 PYRB_ECOLI
81 PsiBlast_CBE 76.5233% -11 - C7 -2FZG 2.8 PYRB_ECOLI
86 PsiBlast_CBE 76.1333% -12 - C7 -2AIR 3.1 PYRB_ECOLI
88 PsiBlast_CBE 76.0833% -11 - C7 -1ZA2 3.2 PYRB_ECOLI
87 PsiBlast_CBE 76.0833% -13 - C7 -1ZA2 3.8 PYRB_ECOLI
122 PsiBlast_CBE 75.8132% -12 - C7 -1TU0 3.6 PYRB_ECOLI
105 PsiBlast_CBE 75.7333% -10 - C7 -1EKX 7.6 PYRB_ECOLI
80 PsiBlast_CBE 75.7033% -9 - C7 -2FZK 3.8 PYRB_ECOLI
10 PsiBlast_PDB 75.6233% -9 - C7 -1ML4 7.9 PYRB_PYRAB
116 PsiBlast_CBE 75.5933% -15 - C7 -2HSE 2.9 PYRB_ECOLI
83 PsiBlast_CBE 75.5433% -8 - C7 -2FZC 2.2 PYRB_ECOLI
84 PsiBlast_CBE 75.4033% -9 - C7 -2FZC 3.3 PYRB_ECOLI
120 PsiBlast_CBE 75.3832% -18 - C7 -1TUG 3.4 PYRB_ECOLI
69 PsiBlast_CBE 75.1833% -9 - C7 -4KGV 7.9 ?
135 PsiBlast_CBE 75.1632% -15 - C7 -3AT1 3.1 PYRB_ECOLI
67 PsiBlast_CBE 75.0133% -10 - C7 -4KGX 7.9 ?
78 PsiBlast_CBE 74.9833% -8 - C7 -2H3E 7.3 PYRB_ECOLI
115 PsiBlast_CBE 74.9733% -15 - C7 -2HSE 3.2 PYRB_ECOLI
108 PsiBlast_CBE 74.9032% -8 - C7 -1D09 6.8 PYRB_ECOLI
72 PsiBlast_CBE 74.8133% -11 - C7 -4F04 8.0 PYRB_ECOLI
103 PsiBlast_CBE 74.7633% -11 - C7 -1EKX 7.6 PYRB_ECOLI
89 PsiBlast_CBE 74.7633% -10 - C7 -1R0C 3.6 PYRB_ECOLI
134 PsiBlast_CBE 74.6932% -14 - C7 -3AT1 3.1 PYRB_ECOLI
123 PsiBlast_CBE 74.6132% -8 - C7 -1TU0 3.8 PYRB_ECOLI
85 PsiBlast_CBE 74.6033% -7 - C7 -2AIR 2.9 PYRB_ECOLI
77 PsiBlast_CBE 74.5133% -10 - C7 -2H3E 7.3 PYRB_ECOLI
61 PsiBlast_CBE 74.5033% -10 - C7 -4KH1 8.1 ?
71 PsiBlast_CBE 74.4933% -9 - C7 -4F04 7.8 PYRB_ECOLI
118 PsiBlast_CBE 74.4332% -11 - C7 -1F1B 5.6 PYRB_ECOLI
90 PsiBlast_CBE 74.4033% -11 - C7 -1R0C 3.7 PYRB_ECOLI
5 PsiBlast_PDB 74.4036% -8 - C7 -4BJH 6.2 PYRB_AQUAE
121 PsiBlast_CBE 74.3432% -10 - C7 -1TUG 4.2 PYRB_ECOLI
119 PsiBlast_CBE 74.3332% -12 - C7 -1F1B 5.9 PYRB_ECOLI
63 PsiBlast_CBE 74.2733% -8 - C7 -4KH0 8.0 ?
109 PsiBlast_CBE 74.2332% -7 - C7 -1D09 7.1 PYRB_ECOLI
60 PsiBlast_CBE 74.1333% -9 - C7 -4KH1 7.9 ?
104 PsiBlast_CBE 74.0133% -7 - C7 -1EKX 7.5 PYRB_ECOLI
124 PsiBlast_CBE 73.9532% -11 - C7 -1TTH 5.8 PYRB_ECOLI
66 PsiBlast_CBE 73.9033% -8 - C7 -4KGX 7.8 ?
75 PsiBlast_CBE 73.8333% -12 - C7 -2IPO 6.5 PYRB_ECOLI
68 PsiBlast_CBE 73.6533% -8 - C7 -4KGV 8.1 ?
137 PsiBlast_CBE 73.4332% -11 - C7 -2AT1 3.1 PYRB_ECOLI
62 PsiBlast_CBE 73.3933% -9 - C7 -4KH0 8.0 ?
76 PsiBlast_CBE 73.3633% -10 - C7 -2IPO 6.0 PYRB_ECOLI
133 PsiBlast_CBE 73.3132% -11 - C7 -7AT1 3.3 PYRB_ECOLI
130 PsiBlast_CBE 73.2632% -5 - C7 -8AT1 2.8 PYRB_ECOLI
129 PsiBlast_CBE 73.2532% -15 - C7 -8ATC 6.3 PYRB_ECOLI
136 PsiBlast_CBE 73.1832% -8 - C7 -2AT1 2.7 PYRB_ECOLI
128 PsiBlast_CBE 73.1332% -10 - C7 -8ATC 6.6 PYRB_ECOLI
131 PsiBlast_CBE 73.0032% -8 - C7 -8AT1 2.7 PYRB_ECOLI
132 PsiBlast_CBE 72.7832% -6 - C7 -7AT1 2.7 PYRB_ECOLI
117 PsiBlast_CBE 71.6533% -12 - C7 -2A0F 2.9 PYRB_ECOLI