@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VM32: (2017-11-05 )
MSQSYIAPVELEKAYRLLNHGPTVLVSAQHGDDRNVMAAAWACALEFKPAKVTVVLDKSTKTRQLVEQSGYFTLQVPCYAQLNMTKQLGIISKLDDPQKLEHCGVELFYQKDLTSPLVSGCIAWLVCKLIPEPHNQSAHDLFIGSVVGAWADSRVFRDGHWHFQDAPKELRSLHYIAGGTFYLIGEEVKADL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_A_2(3HMZ)
?
[Raw transfer]




FMN_A_2(3HMZ)
?
[Raw transfer]




EDO_A_9(3HMZ)
?
[Raw transfer]




32 HHSearch 96.8063%-132 - C3 -3HMZ 9.9 ?
1 PsiBlast_PDB 96.5963%-149 - C3 -3HMZ 9.9 ?
37 HHSearch 67.3928%-130 - C3 -2R6V - Y856_PYRHO -
3 PsiBlast_PDB 67.2029%-139 - C3 -3ZOD - Y856_PYRHO -
4 PsiBlast_PDB 67.0929%-138 - C3 -3ZOG - Y856_PYRHO -
5 PsiBlast_PDB 66.6229%-137 - C3 -2R6V - Y856_PYRHO -
2 PsiBlast_PDB 65.8729%-140 - C3 -3ZOC - Y856_PYRHO -
24 Fugue 62.1423%-109 - C3 -1USC - ? -
7 PsiBlast_PDB 61.6426% -68 - C3 -3E4V - ? -
35 HHSearch 61.5726% -65 - C3 -2D5M - ? -
41 HHSearch 59.8524% -67 - C3 -3E4V - ? -
44 HHSearch 59.8323%-109 - C3 -1USC - ? -
43 HHSearch 59.0623%-110 - C3 -3ZOH - ? -
14 PsiBlast_PDB 56.7122% -23 - C3 -1EJE - P152_METTH -
45 HHSearch 56.5019%-137 - C3 -4R82 - ? -
48 HHSearch 56.4419%-133 - C3 -4HX6 - ? -
47 HHSearch 56.4415%-152 - C3 -3PFT - ? -
33 HHSearch 54.3714% -27 - C3 -3BPK - ? -
8 PsiBlast_PDB 53.2028% -59 - C3 -2D5M - ? -
6 PsiBlast_PDB 53.1723% -80 - C3 -3BNK - ? -