@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VM65: (2017-11-06 )
MSKGQTLQDPFLNSLRKERIPVSIFLVNGIKLQGHIESFDQYVVLLKNTVSQMVYKHAISTVVPARNPRPAGAQGAGFPAQGGSQGGFGGQGAGFGGAQGAGFGGQGGFGGQGGFGGQGGFGGQGGFGGQGGFGGQGGFGGHQGGFGGHQGGFDNDSKFEDGQDDENNR

Atome Classification :

(73 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GAI_A_16(5SZD)
HFQ_AQUAE
[Raw transfer]




GAI_A_16(5SZD)
HFQ_AQUAE
[Raw transfer]




NACID_I_7(4HT8)
?
[Raw transfer]

-

NACID_H_7(4QVD)
?
[Raw transfer]

-

ADP_H_17(3RES)
HFQ_ECOLI
[Raw transfer]




ADP_B_8(3QUI)
HFQ_PSEAE
[Raw transfer]




NACID_D_4(4HT9)
?
[Raw transfer]

-

NACID_H_4(3GIB)
HFQ_ECOLI
[Raw transfer]

-

ATP_C_10(4J5Y)
HFQ_PSEAE
[Raw transfer]




NACID_K_8(4HT8)
?
[Raw transfer]

-

ATP_A_7(4J5Y)
HFQ_PSEAE
[Raw transfer]




NACID_I_7(4HT8)
?
[Raw transfer]

-

ATP_D_10(3QO3)
HFQ_ECOLI
[Raw transfer]




ADP_C_9(3QUI)
HFQ_PSEAE
[Raw transfer]




ADP_I_18(3RES)
HFQ_ECOLI
[Raw transfer]




NACID_K_8(4HT8)
?
[Raw transfer]

-

NACID_D_4(4HT9)
?
[Raw transfer]

-

PEG_L_(5SZD)
HFQ_AQUAE
[Raw transfer]




ANP_D_10(3QUI)
HFQ_PSEAE
[Raw transfer]




NACID_H_7(4QVD)
?
[Raw transfer]

-

ADP_L_20(3RES)
HFQ_ECOLI
[Raw transfer]




ATP_D_11(4J5Y)
HFQ_PSEAE
[Raw transfer]




ADP_A_7(3QUI)
HFQ_PSEAE
[Raw transfer]




ATP_F_14(4J5Y)
HFQ_PSEAE
[Raw transfer]




ADP_F_13(3RER)
HFQ_ECOLI
[Raw transfer]




CTP_E_23(4J6W)
HFQ_PSEAE
[Raw transfer]




CTP_A_7(4J6W)
HFQ_PSEAE
[Raw transfer]




ADP_B_9(3RER)
HFQ_ECOLI
[Raw transfer]




NACID_K_8(4HT8)
?
[Raw transfer]

-

ADP_C_14(3RES)
HFQ_ECOLI
[Raw transfer]




CTP_C_13(4J6W)
HFQ_PSEAE
[Raw transfer]




CTP_D_18(4J6W)
HFQ_PSEAE
[Raw transfer]




ANP_E_13(3QUI)
HFQ_PSEAE
[Raw transfer]




NACID_H_4(3GIB)
HFQ_ECOLI
[Raw transfer]

-

NACID_H_4(3GIB)
HFQ_ECOLI
[Raw transfer]

-

ATP_B_9(4J5Y)
HFQ_PSEAE
[Raw transfer]




NACID_G_7(4QVC)
?
[Raw transfer]

-

ADP_E_12(3RER)
HFQ_ECOLI
[Raw transfer]




ADP_E_15(3RES)
HFQ_ECOLI
[Raw transfer]




ADE_F_14(3QUI)
HFQ_PSEAE
[Raw transfer]




ADP_B_9(3RER)
HFQ_ECOLI
[Raw transfer]




ADP_F_16(3RES)
HFQ_ECOLI
[Raw transfer]




ADP_C_11(3RER)
HFQ_ECOLI
[Raw transfer]




ADP_F_16(3RES)
HFQ_ECOLI
[Raw transfer]




ADP_K_19(3RES)
HFQ_ECOLI
[Raw transfer]




ATP_D_10(3QO3)
HFQ_ECOLI
[Raw transfer]




ADP_C_11(3RER)
HFQ_ECOLI
[Raw transfer]




ADP_C_14(3RES)
HFQ_ECOLI
[Raw transfer]




ATP_A_7(3QO3)
HFQ_ECOLI
[Raw transfer]




ADP_L_20(3RES)
HFQ_ECOLI
[Raw transfer]




NACID_G_7(4QVC)
?
[Raw transfer]

-

ADP_B_13(3RES)
HFQ_ECOLI
[Raw transfer]




ATP_C_9(3QO3)
HFQ_ECOLI
[Raw transfer]




ATP_B_8(3QO3)
HFQ_ECOLI
[Raw transfer]




ADP_F_13(3RER)
HFQ_ECOLI
[Raw transfer]




PEG_L_(5SZD)
HFQ_AQUAE
[Raw transfer]




ADP_I_18(3RES)
HFQ_ECOLI
[Raw transfer]




GAI_C_23(5SZD)
HFQ_AQUAE
[Raw transfer]




GAI_A_16(5SZD)
HFQ_AQUAE
[Raw transfer]




PEG_A_4(5SZE)
HFQ_AQUAE
[Raw transfer]




PEG_L_(5SZD)
HFQ_AQUAE
[Raw transfer]




TRS_E_19(5DY9)
Y1435_METJA
[Raw transfer]




GAI_B_20(5SZD)
HFQ_AQUAE
[Raw transfer]




NACID_K_8(4HT8)
?
[Raw transfer]

-

NACID_D_4(4HT9)
?
[Raw transfer]

-

156 HHSearch 88.4982%-205 - C2 -4RCB - HFQ_ECOLI -
18 PsiBlast_PDB 88.3584%-211 - C2 -2YHT - HFQ_ECOLI -
44 PsiBlast_CBE 87.6479%-177 - C2 -3QUI 2.8 HFQ_PSEAE
15 PsiBlast_PDB 87.4784%-209 - C2 -1HK9 - HFQ_ECOLI -
104 PsiBlast_CBE 87.3584%-210 - C2 -3RER 3.4 HFQ_ECOLI
76 PsiBlast_CBE 87.3184%-225 - C2 -4QVD 4.0 ?
19 PsiBlast_PDB 87.2284%-224 - C2 -4PNO - ? -
8 PsiBlast_PDB 87.2084%-217 - C2 -2Y90 - HFQ_ECOLI -
37 PsiBlast_CBE 86.9879%-181 - C2 -4J5Y 4.2 HFQ_PSEAE
39 PsiBlast_CBE 86.8879%-174 - C2 -4J5Y 2.9 HFQ_PSEAE
82 PsiBlast_CBE 86.7084%-209 - C2 -4HT9 6.5 ?
102 PsiBlast_CBE 86.6684%-221 - C2 -3RER 4.6 HFQ_ECOLI
29 PsiBlast_CBE 86.5879%-193 - C2 -4J6X - HFQ_PSEAE -
9 PsiBlast_PDB 86.5284%-199 - C2 -3QHS - HFQ_ECOLI -
3 PsiBlast_PDB 86.4479%-167 - C2 -3QUI 3.4 HFQ_PSEAE
152 HHSearch 86.3679%-205 - C2 -5I21 - HFQ_PSEA7 -
27 PsiBlast_CBE 86.3479%-171 - C2 -4J6X - HFQ_PSEAE -
11 PsiBlast_PDB 86.2384%-202 - C2 -4V2S - HFQ_ECOLI -
78 PsiBlast_CBE 86.1384%-224 - C2 -4QVC 2.7 ?
93 PsiBlast_CBE 86.0884%-223 - C2 -3RES 3.1 HFQ_ECOLI
114 PsiBlast_CBE 86.0484%-210 - C2 -3GIB 5.7 HFQ_ECOLI
95 PsiBlast_CBE 85.9884%-234 - C2 -3RES 4.1 HFQ_ECOLI
96 PsiBlast_CBE 85.9484%-220 - C2 -3RES 4.1 HFQ_ECOLI
41 PsiBlast_CBE 85.6879%-202 - C2 -3QUI 3.0 HFQ_PSEAE
112 PsiBlast_CBE 85.6584%-218 - C2 -3GIB 7.5 HFQ_ECOLI
92 PsiBlast_CBE 85.5384%-221 - C2 -3RES 5.7 HFQ_ECOLI
43 PsiBlast_CBE 85.5279%-181 - C2 -3QUI 4.0 HFQ_PSEAE
108 PsiBlast_CBE 85.5084%-217 - C2 -3QO3 4.2 HFQ_ECOLI
35 PsiBlast_CBE 85.5079%-186 - C2 -4J6W 2.5 HFQ_PSEAE
83 PsiBlast_CBE 85.4984%-203 - C2 -4HT8 5.3 ?
113 PsiBlast_CBE 85.3984%-205 - C2 -3GIB 7.6 HFQ_ECOLI
36 PsiBlast_CBE 85.3979%-184 - C2 -4J5Y 4.2 HFQ_PSEAE
89 PsiBlast_CBE 85.2684%-223 - C2 -3RES 5.3 HFQ_ECOLI
86 PsiBlast_CBE 85.2584%-209 - C2 -4HT8 5.8 ?
105 PsiBlast_CBE 85.2484%-207 - C2 -3RER 3.4 HFQ_ECOLI
84 PsiBlast_CBE 85.2384%-215 - C2 -4HT8 1.9 ?
31 PsiBlast_CBE 85.1279%-171 - C2 -4J6W 3.5 HFQ_PSEAE
34 PsiBlast_CBE 84.6779%-186 - C2 -4J6W 2.3 HFQ_PSEAE
90 PsiBlast_CBE 84.6084%-214 - C2 -3RES 6.1 HFQ_ECOLI
99 PsiBlast_CBE 84.5284%-212 - C2 -3RES 3.0 HFQ_ECOLI
40 PsiBlast_CBE 84.5179%-182 - C2 -4J5Y 4.3 HFQ_PSEAE
91 PsiBlast_CBE 84.4784%-208 - C2 -3RES 4.3 HFQ_ECOLI
32 PsiBlast_CBE 84.3979%-190 - C2 -4J6W 2.5 HFQ_PSEAE
85 PsiBlast_CBE 84.2084%-215 - C2 -4HT8 6.6 ?
111 PsiBlast_CBE 84.1984%-206 - C2 -3QO3 3.9 HFQ_ECOLI
103 PsiBlast_CBE 84.1484%-213 - C2 -3RER 3.2 HFQ_ECOLI
100 PsiBlast_CBE 84.1284%-211 - C2 -3RES 4.8 HFQ_ECOLI
42 PsiBlast_CBE 84.1279%-180 - C2 -3QUI 5.0 HFQ_PSEAE
4 PsiBlast_PDB 84.1279%-166 - C2 -4J5Y 2.9 HFQ_PSEAE
98 PsiBlast_CBE 84.0184%-205 - C2 -3RES 3.8 HFQ_ECOLI
110 PsiBlast_CBE 83.9584%-207 - C2 -3QO3 3.7 HFQ_ECOLI
107 PsiBlast_CBE 83.8484%-202 - C2 -3QO3 4.9 HFQ_ECOLI
88 PsiBlast_CBE 83.7284%-208 - C2 -4HT8 8.3 ?
109 PsiBlast_CBE 83.6784%-219 - C2 -3QO3 4.2 HFQ_ECOLI
94 PsiBlast_CBE 83.6484%-205 - C2 -3RES 4.8 HFQ_ECOLI
97 PsiBlast_CBE 83.6184%-207 - C2 -3RES 3.3 HFQ_ECOLI
106 PsiBlast_CBE 83.5784%-213 - C2 -3RER 2.9 HFQ_ECOLI
79 PsiBlast_CBE 83.5784%-190 - C2 -4QVC 6.2 ?
87 PsiBlast_CBE 83.5584%-212 - C2 -4HT8 3.3 ?
77 PsiBlast_CBE 83.5384%-192 - C2 -4QVD 5.5 ?
101 PsiBlast_CBE 83.4784%-212 - C2 -3RER 3.9 HFQ_ECOLI
81 PsiBlast_CBE 83.3484%-212 - C2 -4HT9 8.5 ?
45 PsiBlast_CBE 83.1879%-200 - C2 -3QUI 3.3 HFQ_PSEAE
80 PsiBlast_CBE 81.8184%-206 - C2 -4HT9 3.2 ?
122 PsiBlast_CBE 70.9449%-157 - C2 -5SZD Error HFQ_AQUAE
125 PsiBlast_CBE 70.9349%-162 - C2 -5SZD 3.1 HFQ_AQUAE
127 PsiBlast_CBE 70.9249%-155 - C2 -5SZD 3.0 HFQ_AQUAE
117 PsiBlast_CBE 70.1449%-165 - C2 -5SZD 2.8 HFQ_AQUAE
126 PsiBlast_CBE 70.0249%-154 - C2 -5SZD 3.1 HFQ_AQUAE
161 HHSearch 69.4345%-151 - C2 -5SZD Error HFQ_AQUAE
116 PsiBlast_CBE 69.1249%-164 - C2 -5SZD 2.1 HFQ_AQUAE
115 PsiBlast_CBE 68.8749%-152 - C2 -5SZE 2.4 HFQ_AQUAE
162 HHSearch 68.1945%-156 - C2 -5SZD 2.1 HFQ_AQUAE