@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VMH2: (2017-11-08 )
MKLVTAIVKPFKLDDVREALSDIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEIAISDEMVDAVIESITRVASTGKIGDGKIFLTNLEQVIRIRTGETGPDAV

Atome Classification :

(86 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_C_8(1UL3)
GLNB_SYNY3
[Raw transfer]




ATP_A_5(4USI)
?
[Raw transfer]




ATP_D_15(2RD5)
GLNB_ARATH
[Raw transfer]




ATP_C_16(2XZW)
GLNB_SYNE7
[Raw transfer]




ATP_D_15(2RD5)
GLNB_ARATH
[Raw transfer]




ADP_A_7(4CNZ)
?
[Raw transfer]




ATP_B_11(2J9C)
Y059_METJA
[Raw transfer]




ATP_C_14(2RD5)
GLNB_ARATH
[Raw transfer]




ADP_A_3(4CO1)
?
[Raw transfer]




ATP_C_15(3MHY)
?
[Raw transfer]




ATP_A_2(4AFF)
GLNB_SYNE7
[Raw transfer]




ADP_C_9(4CNZ)
?
[Raw transfer]




ATP_B_9(3MHY)
?
[Raw transfer]




ATP_A_2(4AFF)
GLNB_SYNE7
[Raw transfer]




ATP_G_24(2XZW)
GLNB_SYNE7
[Raw transfer]




ATP_D_16(2XUL)
GLNB_SYNE7
[Raw transfer]




ATP_H_25(2XZW)
GLNB_SYNE7
[Raw transfer]




ATP_A_4(4OZN)
?
[Raw transfer]




ATP_B_10(2XUL)
GLNB_SYNE7
[Raw transfer]




ADP_B_8(4CNZ)
?
[Raw transfer]




ADP_D_10(4CNZ)
?
[Raw transfer]




ATP_A_4(4OZN)
?
[Raw transfer]




ADP_F_12(4CNZ)
?
[Raw transfer]




ATP_C_16(2J9C)
Y059_METJA
[Raw transfer]




ATP_B_5(3LF0)
GLNB_MYCTU
[Raw transfer]




ATP_E_19(2XUL)
GLNB_SYNE7
[Raw transfer]




ADP_B_8(3TA1)
?
[Raw transfer]




ATP_A_7(2XUL)
GLNB_SYNE7
[Raw transfer]




ATP_B_13(2XZW)
GLNB_SYNE7
[Raw transfer]




ATP_C_10(2J9E)
Y059_METJA
[Raw transfer]




ADP_A_3(4CO2)
?
[Raw transfer]




ATP_A_4(3LF0)
GLNB_MYCTU
[Raw transfer]




ATP_C_6(3LF0)
GLNB_MYCTU
[Raw transfer]




ADP_D_9(4C3K)
GLNB_SYNE7
[Raw transfer]




ATP_D_19(2XZW)
GLNB_SYNE7
[Raw transfer]




ATP_F_21(2XZW)
GLNB_SYNE7
[Raw transfer]




ATP_A_4(2J9E)
Y059_METJA
[Raw transfer]




ATP_A_4(2J9C)
Y059_METJA
[Raw transfer]




ADP_B_11(2NS1)
GLNK_ECOLI
[Raw transfer]




ADP_A_7(3TA1)
?
[Raw transfer]




ADP_E_11(4CNZ)
?
[Raw transfer]




ADP_F_11(4C3K)
GLNB_SYNE7
[Raw transfer]




ADP_F_12(3TA1)
?
[Raw transfer]




ATP_A_2(5L9N)
GLNB_ECOLI
[Raw transfer]




ATP_E_20(2XZW)
GLNB_SYNE7
[Raw transfer]




ATP_C_9(4OZN)
?
[Raw transfer]




ADP_B_4(4CO0)
?
[Raw transfer]




ATP_D_4(2GNK)
GLNK_ECOLI
[Raw transfer]




ADP_B_5(4CO2)
?
[Raw transfer]




ADP_A_3(3N5B)
?
[Raw transfer]




AMP_A_2(4OZL)
?
[Raw transfer]




ADP_C_8(4C3K)
GLNB_SYNE7
[Raw transfer]




ATP_B_9(3TA2)
?
[Raw transfer]




ADP_D_10(3TA1)
?
[Raw transfer]




ADP_C_13(3NCR)
?
[Raw transfer]




ADP_A_3(4CO0)
?
[Raw transfer]




ATP_B_8(2J9E)
Y059_METJA
[Raw transfer]




ATP_A_3(2EG2)
GLNB_AQUAE
[Raw transfer]




ADP_C_13(3NCR)
?
[Raw transfer]




ADP_C_9(3TA1)
?
[Raw transfer]




ATP_D_10(3TA0)
?
[Raw transfer]




ATP_A_3(2EG2)
GLNB_AQUAE
[Raw transfer]




ADP_E_11(3TA1)
?
[Raw transfer]




ATP_C_13(3TA2)
?
[Raw transfer]




ATP_C_9(3TA0)
?
[Raw transfer]




ADP_B_9(3NCR)
?
[Raw transfer]




ATP_B_8(3TA0)
?
[Raw transfer]




ATP_F_12(3TA0)
?
[Raw transfer]




ADP_B_4(4CO1)
?
[Raw transfer]




ADP_B_4(4CO1)
?
[Raw transfer]




ADP_D_10(3TA1)
?
[Raw transfer]




ATP_A_4(4CO4)
?
[Raw transfer]




ATP_A_7(3TA0)
?
[Raw transfer]




ATP_E_11(3TA0)
?
[Raw transfer]




ATP_A_6(3TA2)
?
[Raw transfer]




ATP_B_7(4CO4)
?
[Raw transfer]




ATP_B_8(3NCQ)
?
[Raw transfer]




AMP_C_9(4CO4)
?
[Raw transfer]




GOL_A_7(1UL3)
GLNB_SYNY3
[Raw transfer]




ADP_E_10(4C3K)
GLNB_SYNE7
[Raw transfer]




AKG_C_16(3MHY)
?
[Raw transfer]




AKG_B_10(3MHY)
?
[Raw transfer]




TLA_A_2(4CO5)
?
[Raw transfer]




9 PsiBlast_PDB 88.0465%-136 - C5 -4CO1 6.0 ?
10 PsiBlast_PDB 87.4765%-133 - C5 -4CO2 6.1 ?
29 PsiBlast_CBE 86.8965%-138 - C5 -4CO2 5.5 ?
142 HHSearch 86.2765%-139 - C5 -4CO1 5.1 ?
30 PsiBlast_CBE 86.2765%-139 - C5 -4CO1 5.1 ?
8 PsiBlast_PDB 86.1965%-155 - C5 -4CO0 5.0 ?
36 PsiBlast_CBE 85.8465%-142 - C5 -4CNZ 5.8 ?
15 PsiBlast_PDB 85.2468%-129 - C5 -2PII - GLNB_ECOLI -
4 PsiBlast_PDB 84.8171%-151 - C5 -2NS1 6.0 GLNK_ECOLI
22 PsiBlast_CBE 84.5970%-140 - C5 -2NUU - GLNK_ECOLI -
21 PsiBlast_CBE 83.8870%-141 - C5 -2NUU - GLNK_ECOLI -
40 PsiBlast_CBE 83.8361%-148 - C5 -3LF0 6.0 GLNB_MYCTU
33 PsiBlast_CBE 83.8365%-118 - C5 -4CNZ 6.7 ?
38 PsiBlast_CBE 83.8265%-130 - C5 -3MHY 7.6 ?
37 PsiBlast_CBE 83.8265%-135 - C5 -3MHY 7.0 ?
14 PsiBlast_PDB 83.5768%-133 - C5 -1PIL - GLNB_ECOLI -
2 PsiBlast_PDB 83.4570%-139 - C5 -2NUU - GLNK_ECOLI -
155 HHSearch 83.3771%-137 - C5 -2NUU - GLNK_ECOLI -
34 PsiBlast_CBE 83.0865%-149 - C5 -4CNZ 6.0 ?
25 PsiBlast_CBE 83.0370%-137 - C5 -2NUU - GLNK_ECOLI -
7 PsiBlast_PDB 82.6565%-143 - C5 -4CNZ 5.9 ?
35 PsiBlast_CBE 82.3065%-141 - C5 -4CNZ 6.7 ?
31 PsiBlast_CBE 82.0265%-150 - C5 -4CO0 4.7 ?
18 PsiBlast_PDB 81.7261%-180 - C5 -3LF0 4.7 GLNB_MYCTU
32 PsiBlast_CBE 81.3965%-135 - C5 -4CNZ 6.3 ?
12 PsiBlast_PDB 81.0665%-160 - C5 -4CO5 3.3 ?
80 PsiBlast_CBE 80.7554%-118 - C5 -2J9E 6.4 Y059_METJA
62 PsiBlast_CBE 79.9558%-125 - C5 -2XZW 7.8 GLNB_SYNE7
156 HHSearch 79.5857%-140 - C5 -4AFF 7.1 GLNB_SYNE7
75 PsiBlast_CBE 79.5857%-140 - C5 -4AFF 7.1 GLNB_SYNE7
46 PsiBlast_CBE 79.5459%-128 - C5 -3N5B 5.5 ?
11 PsiBlast_PDB 79.4565%-174 - C5 -4CO4 4.6 ?
39 PsiBlast_CBE 79.3261%-174 - C5 -3LF0 5.7 GLNB_MYCTU
53 PsiBlast_CBE 79.2458%-140 - C5 -4C3K 5.1 GLNB_SYNE7
51 PsiBlast_CBE 79.2058%-148 - C5 -4C3K 4.5 GLNB_SYNE7
66 PsiBlast_CBE 79.1258%-134 - C5 -2XUL 7.3 GLNB_SYNE7
50 PsiBlast_CBE 77.8858%-135 - C5 -4C3K 4.5 GLNB_SYNE7
60 PsiBlast_CBE 77.8658%-139 - C5 -2XZW 4.8 GLNB_SYNE7
16 PsiBlast_PDB 77.8468%-158 - C5 -5L9N 4.1 GLNB_ECOLI
92 PsiBlast_CBE 77.7754%-126 - C5 -2J9C 6.7 Y059_METJA
57 PsiBlast_CBE 77.7658%-118 - C5 -2XZW 7.1 GLNB_SYNE7
94 PsiBlast_CBE 77.6154%-116 - C5 -2J9C 6.6 Y059_METJA
27 PsiBlast_CBE 77.3765%-174 - C5 -4CO4 4.0 ?
13 PsiBlast_PDB 76.9269%-145 - C5 -2GNK 4.8 GLNK_ECOLI
81 PsiBlast_CBE 76.8954%-124 - C5 -2J9E 5.1 Y059_METJA
93 PsiBlast_CBE 76.8654%-119 - C5 -2J9C 6.4 Y059_METJA
61 PsiBlast_CBE 76.3558%-141 - C5 -2XZW 6.7 GLNB_SYNE7
67 PsiBlast_CBE 76.2558%-135 - C5 -2XUL 7.2 GLNB_SYNE7
65 PsiBlast_CBE 76.0458%-126 - C5 -2XUL 7.2 GLNB_SYNE7
52 PsiBlast_CBE 75.9058%-149 - C5 -4C3K 4.6 GLNB_SYNE7
58 PsiBlast_CBE 75.5058%-119 - C5 -2XZW 5.6 GLNB_SYNE7
99 PsiBlast_CBE 75.4250%-147 - C5 -3TA2 6.4 ?
97 PsiBlast_CBE 75.2950%-149 - C5 -3TA2 6.2 ?
158 HHSearch 75.0348%-130 - C5 -3NCQ 4.2 ?
98 PsiBlast_CBE 74.6450%-153 - C5 -3TA2 6.6 ?
154 HHSearch 74.4364%-166 * C5 *2EG2 4.9 GLNB_AQUAE
45 PsiBlast_CBE 74.4364%-166 - C5 -2EG2 4.9 GLNB_AQUAE
63 PsiBlast_CBE 74.1958%-122 - C5 -2XZW 7.6 GLNB_SYNE7
157 HHSearch 74.1448%-141 - C5 -3NCR 4.7 ?
127 PsiBlast_CBE 74.1448%-141 - C5 -3NCR 4.7 ?
64 PsiBlast_CBE 74.0858%-126 - C5 -2XUL 7.4 GLNB_SYNE7
82 PsiBlast_CBE 74.0354%-130 - C5 -2J9E 5.9 Y059_METJA
28 PsiBlast_CBE 73.2565%-161 - C5 -4CO4 4.5 ?
59 PsiBlast_CBE 72.7958%-126 - C5 -2XZW 7.8 GLNB_SYNE7
149 HHSearch 72.5246%-136 - C5 -4OZN 6.2 ?
124 PsiBlast_CBE 72.5246%-136 - C5 -4OZN 6.2 ?
128 PsiBlast_CBE 72.4948%-131 - C5 -3NCR 4.2 ?
105 PsiBlast_CBE 72.1150%-138 - C5 -3TA1 6.2 ?
100 PsiBlast_CBE 71.9750%-137 - C5 -3TA1 5.8 ?
102 PsiBlast_CBE 71.4350%-143 - C5 -3TA1 6.3 ?
101 PsiBlast_CBE 70.5950%-139 - C5 -3TA1 6.1 ?
79 PsiBlast_CBE 70.4455%-144 - C5 -1UL3 3.1 GLNB_SYNY3
107 PsiBlast_CBE 70.1650%-157 - C5 -3TA0 5.0 ?
104 PsiBlast_CBE 69.9250%-136 - C5 -3TA1 5.6 ?
110 PsiBlast_CBE 69.7150%-163 - C5 -3TA0 5.0 ?
122 PsiBlast_CBE 69.6546%-138 - C5 -4OZN 4.4 ?
103 PsiBlast_CBE 69.6450%-143 - C5 -3TA1 5.6 ?
146 HHSearch 69.5749%-130 - C5 -3TA1 6.3 ?
111 PsiBlast_CBE 69.0050%-154 - C5 -3TA0 4.7 ?
109 PsiBlast_CBE 67.3950%-160 - C5 -3TA0 4.7 ?
108 PsiBlast_CBE 65.7450%-163 - C5 -3TA0 5.4 ?
106 PsiBlast_CBE 65.4050%-158 - C5 -3TA0 4.6 ?
148 HHSearch 64.0546% -64 - C5 -2RD5 5.0 GLNB_ARATH
115 PsiBlast_CBE 60.4348% -50 - C5 -2RD5 5.2 GLNB_ARATH
114 PsiBlast_CBE 59.9948% -66 - C5 -2RD5 5.0 GLNB_ARATH
152 HHSearch 58.4943% -75 - C5 -4USI 6.9 ?