@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VMJ8: (2017-11-08 )
MNKYFAEFLGTFWLVFGGCGSAVLAAAFPELGIGFAGVALAFGLTVLTGAYALGHISGGHFNPAVSVGLWVGGRFDVKDLIPYIVAQVVGATAAAFVLYIIAQGQAGFSGVGGFAANGFGDLSPNKFGLGSAFIIEVVLTAFFLIIILGATDRRAPAGFAPIAIGLGLTLIHLISIPVTNTSVNPARSTGVAFFAETAALSQLWLFWVAPILGAVIGAIIYKVVAGDKD

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MC3_M_13(2B6O)
MIP_SHEEP
[Raw transfer]




3PE_A_8(3M9I)
MIP_SHEEP
[Raw transfer]




BOG_A_3(2O9G)
AQPZ_ECOLI
[Raw transfer]




BNG_G_7(1J4N)
AQP1_BOVIN
[Raw transfer]




25 PsiBlast_CBE 91.8566% 0 - C- -2ABM - AQPZ_ECOLI -
24 PsiBlast_CBE 91.8566% 0 - C- -2ABM - AQPZ_ECOLI -
23 PsiBlast_CBE 91.8566% 0 - C- -2ABM - AQPZ_ECOLI -
22 PsiBlast_CBE 91.8566% 0 - C- -2ABM - AQPZ_ECOLI -
21 PsiBlast_CBE 91.8566% 0 - C- -2ABM - AQPZ_ECOLI -
3 PsiBlast_PDB 91.8566% 0 - C- -2ABM - AQPZ_ECOLI -
90 HHSearch 86.7769%-124 - C7 -3LLQ - AQPZ2_AGRFC -
1 PsiBlast_PDB 85.4370%-121 - C7 -3LLQ - AQPZ2_AGRFC -
91 HHSearch 85.2669%-122 - C7 -3LLQ - AQPZ2_AGRFC -
28 PsiBlast_CBE 81.9665%-117 - C7 -3NKA - AQPZ_ECOLI -
26 PsiBlast_CBE 81.9665%-110 - C7 -3NK5 - AQPZ_ECOLI -
4 PsiBlast_PDB 81.9665%-114 - C7 -3NK5 - AQPZ_ECOLI -
9 PsiBlast_PDB 81.4365%-118 - C7 -3NKA - AQPZ_ECOLI -
27 PsiBlast_CBE 81.3065%-111 - C7 -2O9D - AQPZ_ECOLI -
92 HHSearch 81.1666%-112 - C7 -1RC2 - AQPZ_ECOLI -
89 HHSearch 81.1566%-108 - C7 -2O9G 3.2 AQPZ_ECOLI
6 PsiBlast_PDB 80.8665%-108 - C7 -2O9G - AQPZ_ECOLI -
8 PsiBlast_PDB 80.5965%-110 - C7 -2O9E - AQPZ_ECOLI -
10 PsiBlast_PDB 80.2465%-114 - C7 -3NKC - AQPZ_ECOLI -
2 PsiBlast_PDB 79.7866%-113 - C7 -1RC2 - AQPZ_ECOLI -
45 PsiBlast_CBE 69.9837%-166 - C7 -2B6O 2.3 MIP_SHEEP
46 PsiBlast_CBE 67.9037%-168 - C7 -3M9I 2.3 MIP_SHEEP